Home » Collagen XI alpha 2 » Collagen XI alpha 2 Antibodies » Collagen XI alpha 2 Antibody [Allophycocyanin]

Collagen XI alpha 2 Antibody [Allophycocyanin]

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Collagen XI alpha 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35144APC
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Collagen XI alpha 2 Antibody [Allophycocyanin] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 210-380 of human Collagen XI alpha 2 (NP_542411.2).

Sequence:
IVPGVQAAYESCEQKELECEGGQRERPQNQQPHRAQRSPQQQPSRLHRPQNQEPQSQPTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEEEILESSLLPPLEEEQTDLQVPPTADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSGAAAHGPRG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL11A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Alternate Names for Collagen XI alpha 2 Antibody [Allophycocyanin]

  • collagen alpha-2(XI) chain
  • collagen, type XI, alpha 2
  • DFNA13
  • DFNB53
  • HKE5
  • PARP
  • pro-a2 chain of collagen type XI
  • STL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(430 Publications)
Species: Hu, Mu
Applications: ICC, IHC
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Bcl-2 Antibody -
BSA Free
NB100-56098
Western Blot Bcl-2 Antibody - BSA Free
Western Blot Bcl-2 Antibody - BSA Free
Western Blot Bcl-2 Antibody - BSA Free
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
Bax Antibody
[Unconjugated]
AF820
Western Blot Bax Antibody [Unconjugated]
Immunocytochemistry Bax Antibody [Unconjugated]
Knockout Validated Bax Antibody [Unconjugated]
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(62 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
Caspase-9 Antibody
- BSA Free
NB100-56118
Immunohistochemistry Caspase-9 Antibody - BSA Free
Immunohistochemistry Caspase-9 Antibody - BSA Free
Immunohistochemistry Caspase-9 Antibody - BSA Free
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(26 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
Bcl-xL Antibody -
BSA Free
NB100-56104
Western Blot Bcl-xL Antibody - BSA Free
Immunohistochemistry-Paraffin Bcl-xL Antibody - BSA Free
Western Blot Bcl-xL Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
Caspase-8 Antibody
- BSA Free
NB100-56116
Western Blot Caspase-8 Antibody - BSA Free
Immunohistochemistry-Paraffin Caspase-8 Antibody - BSA Free
Immunohistochemistry-Paraffin Caspase-8 Antibody - BSA Free
(2 Reviews)
(82 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(839 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(52 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC,  IHC-P, WB
D4S234E Antibody
(1C3) - Azide and BSA ...
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(40 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5)
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5)
Immunohistochemistry-Paraffin ERK1 Antibody (1E5)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Collagen XI alpha 2 Antibody (NBP3-35144APC) (0)

There are no publications for Collagen XI alpha 2 Antibody (NBP3-35144APC).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XI alpha 2 Antibody (NBP3-35144APC) (0)

There are no reviews for Collagen XI alpha 2 Antibody (NBP3-35144APC). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XI alpha 2 Antibody (NBP3-35144APC) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen XI alpha 2 Products

Blogs on Collagen XI alpha 2

There are no specific blogs for Collagen XI alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XI alpha 2 Antibody [Allophycocyanin] and receive a gift card or discount.


Bioinformatics

Gene Symbol COL11A2