COL16A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COL16A1 Antibody [NBP1-86395] - Glomerular expression of COL16A1 in human fetal kidney cells. Image from verified customer review.
Immunohistochemistry: COL16A1 Antibody [NBP1-86395] - Staining of human placenta shows strong positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related COL16A1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86395
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

COL16A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVSCIFPVPQLFDLRWHKLMLSVAGRVASVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGKPVSFDLQQVHIYCDPELVLEEGCCELLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL16A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86395 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL16A1 Antibody

  • alpha 1 type XVI collagen
  • collagen alpha-1(XVI) chain
  • collagen XVI, alpha-1 polypeptide
  • collagen, type XVI, alpha 1,447AA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-31415
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-185
Species: Hu
Applications: WB
NBP1-90840
Species: Hu
Applications: IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COL16A1 Antibody (NBP1-86395) (0)

There are no publications for COL16A1 Antibody (NBP1-86395).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for COL16A1 Antibody (NBP1-86395) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ICC/IF.

Reviews using NBP1-86395:
Filter by Applications
ICC/IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry/Immunofluorescence COL16A1 NBP1-86395
Enlarge
reviewed by:
Anonymous
ICC/IF Human 10/20/2016
View

Summary

ApplicationImmunocytochemistry/Immunofluorescence
Sample Testedhuman fetal kidney cells
SpeciesHuman

Comments

Commentslow pH antigen retrieval

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COL16A1 Antibody (NBP1-86395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COL16A1 Products

COL16A1 NBP1-86395

Bioinformatics Tool for COL16A1 Antibody (NBP1-86395)

Discover related pathways, diseases and genes to COL16A1 Antibody (NBP1-86395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL16A1 Antibody (NBP1-86395)

Discover more about diseases related to COL16A1 Antibody (NBP1-86395).
 

Pathways for COL16A1 Antibody (NBP1-86395)

View related products by pathway.

Blogs on COL16A1

There are no specific blogs for COL16A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
10/20/2016
Application: ICC/IF
Species: Human

Bioinformatics

Gene Symbol COL16A1