COG8 Antibody


Western Blot: COG8 Antibody [NBP2-58437] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: COG8 Antibody [NBP2-58437] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

COG8 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL
Specificity of human COG8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COG8 Recombinant Protein Antigen (NBP2-58437PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for COG8 Antibody

  • COG complex subunit 8
  • component of oligomeric golgi complex 8CDG2H
  • conserved oligomeric Golgi complex subunit 8
  • dependent on RIC1
  • DOR1conserved oligomeric golgi complex component 8
  • FLJ22315


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu

Publications for COG8 Antibody (NBP2-58437) (0)

There are no publications for COG8 Antibody (NBP2-58437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG8 Antibody (NBP2-58437) (0)

There are no reviews for COG8 Antibody (NBP2-58437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COG8 Antibody (NBP2-58437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for COG8 Antibody (NBP2-58437)

Discover related pathways, diseases and genes to COG8 Antibody (NBP2-58437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG8 Antibody (NBP2-58437)

Discover more about diseases related to COG8 Antibody (NBP2-58437).

Pathways for COG8 Antibody (NBP2-58437)

View related products by pathway.

PTMs for COG8 Antibody (NBP2-58437)

Learn more about PTMs related to COG8 Antibody (NBP2-58437).

Blogs on COG8

There are no specific blogs for COG8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COG8 Antibody and receive a gift card or discount.


Gene Symbol COG8