Coagulation Factor XI Antibody (2H8)

Images

 
Western Blot: Coagulation Factor XI Antibody (2H8) [H00002160-M01] - Analysis of F11 expression in transfected 293T cell line by F11 monoclonal antibody (M01), clone 2H8.Lane 1: F11 transfected lysate(70.1 KDa).Lane 2: ...read more
Immunoprecipitation: Coagulation Factor XI Antibody (2H8) [H00002160-M01] - Analysis of F11 transfected lysate using anti-F11 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with F11 MaxPab rabbit ...read more
Sandwich ELISA: Coagulation Factor XI Antibody (2H8) [H00002160-M01] - Detection limit for recombinant GST tagged F11 is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Coagulation Factor XI Antibody (2H8) Summary

Immunogen
F11 (NP_000119 286 a.a. - 385 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIK
Specificity
F11 - coagulation factor XI (plasma thromboplastin antecedent)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F11
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coagulation Factor XI Antibody (2H8)

  • Coagulation Factor XI
  • EC 3.4.21
  • EC 3.4.21.27
  • FXIPlasma thromboplastin antecedent
  • MGC141891
  • PTA

Background

This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for Coagulation Factor XI Antibody (H00002160-M01) (0)

There are no publications for Coagulation Factor XI Antibody (H00002160-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor XI Antibody (H00002160-M01) (0)

There are no reviews for Coagulation Factor XI Antibody (H00002160-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor XI Antibody (H00002160-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Coagulation Factor XI Products

Bioinformatics Tool for Coagulation Factor XI Antibody (H00002160-M01)

Discover related pathways, diseases and genes to Coagulation Factor XI Antibody (H00002160-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor XI Antibody (H00002160-M01)

Discover more about diseases related to Coagulation Factor XI Antibody (H00002160-M01).
 

Pathways for Coagulation Factor XI Antibody (H00002160-M01)

View related products by pathway.

PTMs for Coagulation Factor XI Antibody (H00002160-M01)

Learn more about PTMs related to Coagulation Factor XI Antibody (H00002160-M01).
 

Research Areas for Coagulation Factor XI Antibody (H00002160-M01)

Find related products by research area.

Blogs on Coagulation Factor XI

There are no specific blogs for Coagulation Factor XI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coagulation Factor XI Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol F11
Entrez
OMIM
Uniprot