CLK2 Recombinant Protein Antigen

Images

 
There are currently no images for CLK2 Protein (NBP2-47506PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLK2.

Source: E.coli

Amino Acid Sequence: HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47506.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CLK2 Recombinant Protein Antigen

  • CDC-like kinase 2
  • CDC-like kinase 2CLK kinase
  • CLK2
  • dual specificity protein kinase CLK2
  • EC 2.7.12.1
  • hCLK2
  • MGC61500

Background

The CLK2 gene encodes a member of the CLK family of dual specificity protein kinases. CLK family members have been shown tointeract with, and phosphorylate, serine- and arginine-rich (SR) proteins of the spliceosomal complex, which is a partof the regulatory

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-87194
Species: Hu
Applications: WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-98496
Species: Hu
Applications: WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
5025-CL
Species: Hu
Applications: Bind
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-89996
Species: Hu
Applications: IHC, IHC-P, WB
AF6387
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF5344
Species: Hu, Mu
Applications: WB
H00001198-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-15143
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-91876
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-139
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP1-88343
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB

Publications for CLK2 Protein (NBP2-47506PEP) (0)

There are no publications for CLK2 Protein (NBP2-47506PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLK2 Protein (NBP2-47506PEP) (0)

There are no reviews for CLK2 Protein (NBP2-47506PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLK2 Protein (NBP2-47506PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLK2 Products

Bioinformatics Tool for CLK2 Protein (NBP2-47506PEP)

Discover related pathways, diseases and genes to CLK2 Protein (NBP2-47506PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLK2 Protein (NBP2-47506PEP)

Discover more about diseases related to CLK2 Protein (NBP2-47506PEP).
 

Pathways for CLK2 Protein (NBP2-47506PEP)

View related products by pathway.

PTMs for CLK2 Protein (NBP2-47506PEP)

Learn more about PTMs related to CLK2 Protein (NBP2-47506PEP).
 

Research Areas for CLK2 Protein (NBP2-47506PEP)

Find related products by research area.

Blogs on CLK2

There are no specific blogs for CLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLK2