Home » CLK2 » CLK2 Proteins » CLK2 Recombinant Protein Antigen

CLK2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLK2 Protein (NBP2-47506PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CLK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLK2.

Source: E.coli

Amino Acid Sequence: HPRRYHSSERGSRGSYREHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDR
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47506.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CLK2 Recombinant Protein Antigen

  • CDC-like kinase 2
  • CDC-like kinase 2CLK kinase
  • CLK2
  • dual specificity protein kinase CLK2
  • EC 2.7.12.1
  • hCLK2
  • MGC61500

Background

The CLK2 gene encodes a member of the CLK family of dual specificity protein kinases. CLK family members have been shown tointeract with, and phosphorylate, serine- and arginine-rich (SR) proteins of the spliceosomal complex, which is a partof the regulatory

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLK1 Antibody
NBP2-87194
Western Blot: CLK1 Antibody [NBP2-87194] - WB Suggested Anti-CLK1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysateCLK1 is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: CLK1 Antibody [NBP2-87194] - MCF-7 and HeLa whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. CLK1 Antibody (NBP2-87194) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.
(1 Review)
Species: Hu
Applications: WB
Chk1 Antibody
NB100-464
Immunoprecipitation: Chk1 Antibody [NB100-464] - Detection of human Chk1 by western blot of immunoprecipitates. Samples: Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-Chk1 antibody NB100-464 (lot 2) used for IP at 6 ug/mg lysate. Chk1 was also immunoprecipitated by a previous lot (lot 1) of this antibody. For blotting immunoprecipitated Chk1, NB100-464 (lot 2) was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: Chk1 Antibody [NB100-464] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-CHK1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Chk1 Antibody [NB100-464] - Knockout of ORC2 in HCT116 p53-/- cells. Western blot of ORC2 in HBEC and 293T cell lines. Ponceau S staining of total protein or immunoblot of Chk1 show equal loading of the pairs of lanes. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/19084), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
COQ7 Antibody
NBP1-98496
Western Blot: COQ7 Antibody [NBP1-98496] - MDA-MB-435S Cell Lysate 1.0ug/ml, Gel Concentration: 12%
(1 Publication)
Species: Hu
Applications: WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
Western Blot: ATR Antibody (2B5) [NB100-308] - Raji whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody diluted at 1:500.
(19 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
CL-K1/COLEC11
5025-CL
CL-K1/COLEC11
(1 Publication)
Species: Hu
Applications: Bind
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Human colon stained with TEM8 antibody at 2.5 ug/ml concentration using DAB chromogen detection method (10X magnification)
Immunohistochemistry-Paraffin: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Detection of TEM8/ANTXR1 in human liver cancer section using 5 ug/ml concentration of TEM8 antibody. Uniform weak staining was observed in the cancerous cells, while the blood vessels depicted the expected intense positivity for TEM8.
Western Blot: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Analysis of human heart lysates (35ug per lane, RIPA buffer) using TEM8 antibody (NB100-56585) at 0.3ug/ml. Band observed at 65kDa. (Expected MW of 62.8kDa according to NP_115584.1).
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry: MMAB Antibody (2G5) [NBP2-03417] - Analysis of Jurkat cells, using anti-MMAB antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MMAB antibody, and then analyzed by flow cytometry.
Western Blot: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MMAB (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MMAB.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot: gamma-Synuclein Antibody [NBP1-89996] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody [NBP1-89996] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: gamma-Synuclein Antibody [NBP1-89996] - Staining of human adrenal gland shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SCAMP3 Antibody
AF5344
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line and K562 human chronic myelogenous leukemia cell line, HepG2 human hepatocellular carcinoma cell line, and JEG‑3 human epithelial choriocarcinoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse SCAMP3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5344) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SCAMP3 at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
CLK3 Antibody
(1F10)
H00001198-M05
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - HeLa cell lysate. Antibody at 1:2000 in 5% BSA-TBST. Detection by Clarity Western ECL (BioRad). Image from verfied customer review.
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 expression in transfected 293T cell line by CLK3 monoclonal antibody (M05), clone 1F10. Lane 1: CLK3 transfected lysatE (58.6 KDa). Lane 2: Non-transfected lysate.
Western Blot: CLK3 Antibody (1F10) [H00001198-M05] - Analysis of CLK3 over-expressed 293 cell line, cotransfected with CLK3 Validated Chimera RNAi or non-transfected control. Blot probed with H00001198-M05. GAPDH (36.1 kDa) used as loading control.
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
TRA2B Antibody
NBP2-15143
Immunohistochemistry-Paraffin: TRA2B Antibody [NBP2-15143] - Paraffin-embedded mouse stomach. TRA2B antibody dilution: 1:500.
Immunohistochemistry-Paraffin: TRA2B Antibody [NBP2-15143] - Paraffin-embedded rat fore brain. TRA2B antibody dilution: 1:500.
Immunohistochemistry-Paraffin: TRA2B Antibody [NBP2-15143] - Paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
FAAP24 Antibody
NBP1-91876
Immunohistochemistry-Paraffin: FAAP24 Antibody [NBP1-91876] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
Immunocytochemistry/Immunofluorescence: FAAP24 Antibody [NBP1-91876] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Glucosylceramidase/GBA
H00002629-M01
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01), clone 2E2.Lane 1: GBA transfected lysate(60 KDa).Lane 2: Non-transfected lysate.
ELISA: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Detection limit for recombinant GST tagged GBA is approximately 1ng/ml as a capture antibody.
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Effect of Diltiazem on L444P and N370S/V394L GC Folding and Trafficking.Western blot analysis of untreated and diltiazem-treated L444P GC cells. L444P GC cells were cultured without or with diltiazem at varying concentrations for 7 d before the cells were lysed for SDS-PAGE and Western blot analysis. GC was detected using mouse anti-GC antibody 2E2. Beta-actin served as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pbio.0060026) licensed under a CC-BY licence.
(1 Review)
(7 Publications)
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
EGLN3/PHD3
Antibody - BSA Free
NB100-139
Knockdown Validated: EGLN3/PHD3 Antibody [NB100-139] - PHD3 is required for SCC cell survival in prolonged hypoxia. PHD3 is induced in hypoxia. Knock-down of PHD3 expression with siRNA (siPHD3) is specific and does not affect PHD2 or HIF-1 alpha expression. siScr = scrambled control siRNA. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0014617), licensed under a CC-BY licence.
Knockdown Validated: EGLN3/PHD3 Antibody [NB100-139] - BxPC3 cells stably transduced with retrovirus containing PHD3Wt (BxPC3-Wt), Vector (BxPC3-Vec) or anti-PHD3 shRNA (BxPC3-KD) were harvested for RNA and protein following 24 hours exposure to normoxia (21% O2) or hypoxia (1% O2). Whole cell lysate from BxPC3-Wt, BxPC3-Vec and BxPC3-KD cells following 24 hours exposure to normoxia (N) or hypoxia (H) was resolved by SDS-PAGE and blotted for actin (top) and PHD3 (bottom). PHD3 band intensity was quantified relative to actin in each lane and then normalized to BxPC3-Vec (N). Relative band intensity is indicated below the figure. NS = non-specific band running just above PHD3 band. Data is representative of >3 biological replicates. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0083021), licensed under a CC-BY licence.
Western Blot: EGLN3/PHD3 Antibody [NB100-139] - The HIF-1 response is not impaired in prostate and breast carcinoma cell lines that lack PHD3. Melanoma, breast and prostate cancer cell lines with methylated PHD3 promoters (MB-435, PC-3) and non-methylated promoters (MCF7, DU 145) were subjected to hypoxia (1% O2) or normoxia for 24 hours. Thirty micrograms of whole cell lysate was western blotted for the presence of PHD3; actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0014617), licensed under a CC-BY licence.
(2 Reviews)
(47 Publications)
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line untreated (-) or treated (+) with 0.2 mg/mL Pervanadate (PV) for 30 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-PYK2/FAK2 (Y402) at approximately 113 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human Phospho-PYK2/FAK2 (Y402) Monoclonal Antibody (Catalog # MAB6210). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 30 minutes and 10 µg/mL Mouse Anti-Human CD3 epsilon Monoclonal Antibody (Catalog # MAB100) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Phospho-PYK2/FAK2 (Y402) Monoclonal Antibody (Catalog # MAB6210) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for Phospho-PYK2/FAK2 (Y402) at approximately 105-115 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: Simple Western, WB
FAM189B Antibody
NBP1-88343
Western Blot: FAM189B Antibody [NBP1-88343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Western Blot: FAM189B Antibody [NBP1-88343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: FAM189B Antibody [NBP1-88343] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TRRAP Antibody
AF7365
Western blot shows lysates of MOLT‑4 human acute lymphoblastic leukemia cell line, HeLa human cervical epithelial carcinoma cell line, mouse placenta tissue, mouse uterus tissue, and rat ovary tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human TRRAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7365) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for TRRAP at approximately 440 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB

Publications for CLK2 Protein (NBP2-47506PEP) (0)

There are no publications for CLK2 Protein (NBP2-47506PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLK2 Protein (NBP2-47506PEP) (0)

There are no reviews for CLK2 Protein (NBP2-47506PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLK2 Protein (NBP2-47506PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLK2 Products

Bioinformatics Tool for CLK2 Protein (NBP2-47506PEP)

Discover related pathways, diseases and genes to CLK2 Protein (NBP2-47506PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLK2 Protein (NBP2-47506PEP)

Discover more about diseases related to CLK2 Protein (NBP2-47506PEP).
 

Pathways for CLK2 Protein (NBP2-47506PEP)

View related products by pathway.

PTMs for CLK2 Protein (NBP2-47506PEP)

Learn more about PTMs related to CLK2 Protein (NBP2-47506PEP).
 

Research Areas for CLK2 Protein (NBP2-47506PEP)

Find related products by research area.

Blogs on CLK2

There are no specific blogs for CLK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Knockdown Validated: EGLN3/PHD3 Antibody [NB100-139] - PHD3 is required for SCC cell survival in prolonged hypoxia. PHD3 is induced in hypoxia. Knock-down of PHD3 expression with siRNA (siPHD3) is specific and does not affect PHD2 or HIF-1 alpha expression. siScr = scrambled control siRNA. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0014617), licensed under a CC-BY licence.
EGLN3/PHD3 Antibody - BSA Free
NB100-139

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLK2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLK2