CLIC3 Antibody (2C5)

Images

 
ELISA: CLIC3 Antibody (2C5) [H00009022-M04] - Detection limit for recombinant GST tagged CLIC3 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLIC3 Antibody (2C5) Summary

Immunogen
CLIC3 (NP_004660, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Specificity
CLIC3 - chloride intracellular channel 3 (2C5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLIC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLIC3 Antibody (2C5)

  • chloride intracellular channel 3
  • chloride intracellular channel protein 3

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00053405-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85574
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
21630002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
NBP2-32516
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009363-M04
Species: Hu
Applications: WB, ELISA, S-ELISA
AF5286
Species: Hu
Applications: WB
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CLIC3 Antibody (H00009022-M04) (0)

There are no publications for CLIC3 Antibody (H00009022-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC3 Antibody (H00009022-M04) (0)

There are no reviews for CLIC3 Antibody (H00009022-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIC3 Antibody (H00009022-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLIC3 Products

Bioinformatics Tool for CLIC3 Antibody (H00009022-M04)

Discover related pathways, diseases and genes to CLIC3 Antibody (H00009022-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC3 Antibody (H00009022-M04)

Discover more about diseases related to CLIC3 Antibody (H00009022-M04).
 

Pathways for CLIC3 Antibody (H00009022-M04)

View related products by pathway.

PTMs for CLIC3 Antibody (H00009022-M04)

Learn more about PTMs related to CLIC3 Antibody (H00009022-M04).

Blogs on CLIC3

There are no specific blogs for CLIC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC3 Antibody (2C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC3
Entrez
Uniprot