Claudin-16 Antibody (1F2)

Images

 
Western Blot: Claudin-16 Antibody (1F2) [H00010686-M02] - Analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.Lane 1: CLDN16 transfected lysate(33.8 KDa).Lane 2: ...read more
ELISA: Claudin-16 Antibody (1F2) [H00010686-M02] - Detection limit for recombinant GST tagged CLDN16 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Claudin-16 Antibody (1F2) Summary

Immunogen
CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD
Specificity
CLDN16 - claudin 16 (1F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLDN16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00010686-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-16 Antibody (1F2)

  • claudin 16
  • Claudin16
  • Claudin-16
  • CLDN16
  • HOMG3
  • HOMG3paracellin-1
  • Paracellin-1
  • PCLN1
  • PCLN-1
  • PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00149461-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
H00009076-M01
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87402
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-66784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-12906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB4279
Species: Hu
Applications: Flow, CyTOF-ready

Publications for Claudin-16 Antibody (H00010686-M02)(1)

Reviews for Claudin-16 Antibody (H00010686-M02) (0)

There are no reviews for Claudin-16 Antibody (H00010686-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-16 Antibody (H00010686-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Claudin-16 Products

Bioinformatics Tool for Claudin-16 Antibody (H00010686-M02)

Discover related pathways, diseases and genes to Claudin-16 Antibody (H00010686-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-16 Antibody (H00010686-M02)

Discover more about diseases related to Claudin-16 Antibody (H00010686-M02).
 

Pathways for Claudin-16 Antibody (H00010686-M02)

View related products by pathway.

Blogs on Claudin-16

There are no specific blogs for Claudin-16, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-16 Antibody (1F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN16
Entrez
Uniprot