Claudin-16 Antibody (1F2)

Western Blot: Claudin-16 Antibody (1F2) [H00010686-M02] - Analysis of CLDN16 expression in transfected 293T cell line by CLDN16 monoclonal antibody (M02), clone 1F2.Lane 1: CLDN16 transfected lysate(33.8 KDa).Lane 2: Non-transfected lysate.

ELISA: Claudin-16 Antibody (1F2) [H00010686-M02] - Detection limit for recombinant GST tagged CLDN16 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Claudin-16 Antibody (1F2) Summary

• Immunogen: CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD
• Specificity: CLDN16 - claudin 16 (1F2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CLDN16
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-16 Antibody (1F2)

• claudin 16
• Claudin16
• Claudin-16
• CLDN16
• HOMG3
• HOMG3paracellin-1
• Paracellin-1
• PCLN1
• PCLN-1
• PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-16 Antibody (H00010686-M02)(1)

Publication using H00010686-M02

• Hurd TW, Otto EA, Mishima E et al. Mutation of the Mg2+ Transporter SLC41A1 Results in a Nephronophthisis-Like Phenotype. J Am Soc Nephrol 2013 May [PMID: 23661805]

Bioinformatics

• Gene Symbol: CLDN16
• Entrez:
  • 10686(Human)
• Uniprot:
  • NP_006571()