| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1F2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse Claudin-16 Antibody (1F2) - Azide and BSA Free (H00010686-M02) is a monoclonal antibody validated for use in WB and ELISA. Anti-Claudin-16 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | CLDN16 (UniProt Accession # A0SDD8, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD This sequence also corresponds to transcript ID ENST00000456423.1. |
| Specificity | CLDN16 - claudin 16 (1F2) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CLDN16 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00010686-M02 | Applications | Species |
|---|---|---|
| Hurd TW, Otto EA, Mishima E et al. Mutation of the Mg2+ Transporter SLC41A1 Results in a Nephronophthisis-Like Phenotype. J Am Soc Nephrol 2013-05-01 [PMID: 23661805] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Claudin-16 Antibody (H00010686-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.