Recombinant Human Clathrin interactor 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Clathrin interactor 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 161-261 of Human ENTH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEFKDEEETVTTKH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLINT1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Clathrin interactor 1 Protein

  • clathrin interacting protein localized in the trans-Golgi region
  • clathrin interactor 1
  • Clathrin-interacting protein localized in the trans-Golgi region
  • CLINT
  • ENTHClint
  • enthoprotin
  • EPN4Enthoprotin
  • EPNRepsin 4
  • Epsin-4
  • EpsinR
  • Epsin-related protein
  • FLJ46753
  • KIAA0171epsinR

Background

Epsin R is enriched in clathrin-coated vesicles and associates with clathrin and AP1 (adaptor protein complex 1). EpsinR plays a role in transport of vesicles in the endosomal/trans-Golgi network and at the synapses of neurons. The EpsinR gene has been associated with the genetic susceptibility to schizophrenia. Alternative names for EpsinR include Epsin-4, Epsin-related protein, enthoprotin, clathrin interactor 1, Clint, CLINT1, ENTH, EPN4, EPNR, and KIAA0171.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31589
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NB300-203
Species: Hu, Mu, Rt(-)
Applications: WB, ChIP, ICC/IF, IHC-P, IP
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00009685-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01) (0)

There are no publications for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01) (0)

There are no reviews for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Clathrin interactor 1 Products

Bioinformatics Tool for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01)

Discover related pathways, diseases and genes to Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01)

Discover more about diseases related to Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01).
 

Pathways for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01)

View related products by pathway.

PTMs for Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01)

Learn more about PTMs related to Clathrin interactor 1 Partial Recombinant Protein (H00009685-Q01).

Blogs on Clathrin interactor 1

There are no specific blogs for Clathrin interactor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Clathrin interactor 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLINT1