CL-P1/COLEC12 Recombinant Protein Antigen

Images

 
There are currently no images for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CL-P1/COLEC12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COLEC12.

Source: E. coli

Amino Acid Sequence: ITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COLEC12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33508.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CL-P1/COLEC12 Recombinant Protein Antigen

  • CL-P1
  • CLP1hCL-P1
  • COLEC12
  • collectin placenta 1
  • Collectin placenta protein 1
  • collectin sub-family member 12
  • collectin-12
  • NSR2
  • Nurse cell scavenger receptor 2
  • SCARA4
  • SCARA4NSR2
  • Scavenger receptor class A member 4
  • scavenger receptor class A, member 4
  • SRCL Type I
  • SRCLScavenger receptor with C-type lectin

Background

Colec12 encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor, a cell surface glycoprotein that can bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. In addition, these receptors can recognize oxidized phospholipids so they may also participate in removing oxidatively damaged or apoptotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-12787
Species: Hu
Applications: IP, WB
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB161
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
7268-CT
Species: Hu
Applications: BA
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
AF2956
Species: Mu
Applications: WB
NBP2-13955
Species: Hu
Applications: IHC,  IHC-P, WB
AF1564
Species: Mu
Applications: Block, WB

Publications for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP) (0)

There are no publications for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP) (0)

There are no reviews for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CL-P1/COLEC12 Recombinant Protein Antigen (NBP2-33508PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CL-P1/COLEC12 Products

Blogs on CL-P1/COLEC12

There are no specific blogs for CL-P1/COLEC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CL-P1/COLEC12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COLEC12