CKS2 Antibody (1G8)


Immunocytochemistry/ Immunofluorescence: CKS2 Antibody (1G8) [H00001164-M03] - Analysis of monoclonal antibody to CKS2 on HeLa cell. Antibody concentration 40 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

CKS2 Antibody (1G8) Summary

CKS2 (NP_001818, 1 a.a. - 79 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
CKS2 - CDC28 protein kinase regulatory subunit 2 (1G8)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKS2 Antibody (1G8)

  • CDC28 protein kinase 2
  • CDC28 protein kinase regulatory subunit 2
  • CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2
  • CKS-2
  • CKSHS2
  • cyclin-dependent kinases regulatory subunit 2


CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu

Publications for CKS2 Antibody (H00001164-M03) (0)

There are no publications for CKS2 Antibody (H00001164-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKS2 Antibody (H00001164-M03) (0)

There are no reviews for CKS2 Antibody (H00001164-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CKS2 Antibody (H00001164-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CKS2 Products

Bioinformatics Tool for CKS2 Antibody (H00001164-M03)

Discover related pathways, diseases and genes to CKS2 Antibody (H00001164-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKS2 Antibody (H00001164-M03)

Discover more about diseases related to CKS2 Antibody (H00001164-M03).

Pathways for CKS2 Antibody (H00001164-M03)

View related products by pathway.

PTMs for CKS2 Antibody (H00001164-M03)

Learn more about PTMs related to CKS2 Antibody (H00001164-M03).

Research Areas for CKS2 Antibody (H00001164-M03)

Find related products by research area.

Blogs on CKS2

There are no specific blogs for CKS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CKS2 Antibody (1G8) and receive a gift card or discount.


Gene Symbol CKS2