CKII alpha prime polypeptide Antibody

Images

 
Western Blot: CKII alpha prime polypeptide Antibody [H00001459-D01P] - Analysis of CSNK2A2 expression in transfected 293T cell line by CSNK2A2 polyclonal antibody.Lane 1: CSNK2A2 transfected lysate(41.20 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CKII alpha prime polypeptide Antibody Summary

Immunogen
CSNK2A2 (NP_001887.1, 1 a.a. - 350 a.a.) full-length human protein. MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Specificity
Reacts with casein kinase 2, alpha prime polypeptide.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSNK2A2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKII alpha prime polypeptide Antibody

  • casein kinase 2, alpha prime polypeptide
  • casein kinase II subunit alpha'
  • CK II alpha'
  • CK2A2
  • CSNK2A1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43934

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-84581
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-52449
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC
NBP2-35006
Species: Hu
NBP1-89326
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-13636
Species: Hu
Applications: IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-91966
Species: Hu
Applications: IHC, IHC-P
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
H00001459-D01P
Species: Hu
Applications: WB

Publications for CKII alpha prime polypeptide Antibody (H00001459-D01P) (0)

There are no publications for CKII alpha prime polypeptide Antibody (H00001459-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKII alpha prime polypeptide Antibody (H00001459-D01P) (0)

There are no reviews for CKII alpha prime polypeptide Antibody (H00001459-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKII alpha prime polypeptide Antibody (H00001459-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CKII alpha prime polypeptide Antibody (H00001459-D01P)

Discover related pathways, diseases and genes to CKII alpha prime polypeptide Antibody (H00001459-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKII alpha prime polypeptide Antibody (H00001459-D01P)

Discover more about diseases related to CKII alpha prime polypeptide Antibody (H00001459-D01P).
 

Pathways for CKII alpha prime polypeptide Antibody (H00001459-D01P)

View related products by pathway.

PTMs for CKII alpha prime polypeptide Antibody (H00001459-D01P)

Learn more about PTMs related to CKII alpha prime polypeptide Antibody (H00001459-D01P).
 

Research Areas for CKII alpha prime polypeptide Antibody (H00001459-D01P)

Find related products by research area.

Blogs on CKII alpha prime polypeptide

There are no specific blogs for CKII alpha prime polypeptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKII alpha prime polypeptide Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2A2
Entrez
Uniprot