CIPAR-1 Antibody - BSA Free

Western Blot: CIPAR-1 Antibody [NBP2-82689] - Host: Rabbit. Target Name: PARM1. Sample Type: NCI-H226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CIPAR-1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CIPAR-1 Antibody - BSA Free (NBP2-82689) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CIPAR-1. Peptide sequence: GSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQSAA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CIPAR-1 Antibody - BSA Free

• Castration-induced prostatic apoptosis-related protein 1
• CIPAR-1
• Prostatic androgen-repressed message 1 protein
• Protein PARM-1 [Precursor]

Background

Cipar1 may be involved in a survival program enabling certain prostatic cells to resist apoptosis. It is expressed in prostate and detected in other organs at low levels, these include the heart and various tissues of the urogenital tract; not detected in mammary gland.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PARM1