CIB1 Recombinant Protein Antigen

Images

 
There are currently no images for CIB1 Recombinant Protein Antigen (NBP2-68646PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CIB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CIB1.

Source: E. coli

Amino Acid Sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CIB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68646.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CIB1 Recombinant Protein Antigen

  • calcium and integrin binding 1 (calmyrin)
  • Calcium- and integrin-binding protein
  • Calmyrin
  • CIB1
  • CIBcalcium and integrin binding protein
  • CIBP
  • DNA-dependent protein kinase interacting protein
  • DNA-PKcs-interacting protein
  • Kinase-interacting protein
  • KIP
  • KIP1
  • KIPcalcium and integrin binding, protein kinase interacting protein
  • PRKDCIP
  • SIP2-28
  • SIP2-28calcium and integrin-binding protein 1
  • Snk interacting protein 2-28
  • SNK-interacting protein 2-28

Background

CIB1(also designated calcium and integrin binding 1 or calmyrin),with 191-amino acid protein(about 21kDa), belongs to the calcium-binding protein family.CIB1 is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining.CIB1 is an EF-hand-containing protein that binds multiple effector proteins, including the platelet alpha(IIb)beta(3) integrin and several serine/threonine kinases and potentially modulates their function.CIB1 regulates platelet aggregation in hemostasis through a specific interaction with the alpha(IIb) cytoplasmic domain of platelet integrin alpha(IIb)beta(3). CIB1 is also ubiquitously expressed activating and inhibiting protein ligand of the InsP3R.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-68858
Species: Hu
Applications: IHC,  IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for CIB1 Recombinant Protein Antigen (NBP2-68646PEP) (0)

There are no publications for CIB1 Recombinant Protein Antigen (NBP2-68646PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIB1 Recombinant Protein Antigen (NBP2-68646PEP) (0)

There are no reviews for CIB1 Recombinant Protein Antigen (NBP2-68646PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CIB1 Recombinant Protein Antigen (NBP2-68646PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIB1 Products

Research Areas for CIB1 Recombinant Protein Antigen (NBP2-68646PEP)

Find related products by research area.

Blogs on CIB1.

IRE1 alpha dependent apoptotic-signaling pathway
Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CIB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CIB1