CIB1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CIB1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CIB1.
  
  

  Source: E. coli

  Amino Acid Sequence: SGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CIB1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68646.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CIB1 Recombinant Protein Antigen

• calcium and integrin binding 1 (calmyrin)
• Calcium- and integrin-binding protein
• Calmyrin
• CIB1
• CIBcalcium and integrin binding protein
• CIBP
• DNA-dependent protein kinase interacting protein
• DNA-PKcs-interacting protein
• Kinase-interacting protein
• KIP
• KIP1
• KIPcalcium and integrin binding, protein kinase interacting protein
• PRKDCIP
• SIP2-28
• SIP2-28calcium and integrin-binding protein 1
• Snk interacting protein 2-28
• SNK-interacting protein 2-28

Background

CIB1(also designated calcium and integrin binding 1 or calmyrin),with 191-amino acid protein(about 21kDa), belongs to the calcium-binding protein family.CIB1 is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining.CIB1 is an EF-hand-containing protein that binds multiple effector proteins, including the platelet alpha(IIb)beta(3) integrin and several serine/threonine kinases and potentially modulates their function.CIB1 regulates platelet aggregation in hemostasis through a specific interaction with the alpha(IIb) cytoplasmic domain of platelet integrin alpha(IIb)beta(3). CIB1 is also ubiquitously expressed activating and inhibiting protein ligand of the InsP3R.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CIB1