CHST11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CHST11 Antibody [NBP2-30481] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: CHST11 Antibody [NBP2-30481] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHST11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHST11 Protein (NBP2-30481PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHST11 Antibody

  • C4S-1
  • C4ST
  • C4ST-1
  • C4ST1EC 2.8.2.5
  • carbohydrate (chondroitin 4) sulfotransferase 11
  • carbohydrate sulfotransferase 11
  • Chondroitin 4-O-sulfotransferase 1
  • Chondroitin 4-sulfotransferase 1
  • DKFZp667A035
  • FLJ41682
  • HSA269537
  • IgH/CHST11 fusion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81727
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
MAB7450
Species: Hu
Applications: IHC
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83396
Species: Hu
Applications: IHC, IHC-P
NBP1-88367
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-59944
Species: Hu
Applications: WB
NBP2-57389
Species: Hu
Applications: WB, IHC-P
NBP2-15898
Species: Hu, Mu
Applications: WB

Publications for CHST11 Antibody (NBP2-30481) (0)

There are no publications for CHST11 Antibody (NBP2-30481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST11 Antibody (NBP2-30481) (0)

There are no reviews for CHST11 Antibody (NBP2-30481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CHST11 Antibody (NBP2-30481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHST11 Products

Bioinformatics Tool for CHST11 Antibody (NBP2-30481)

Discover related pathways, diseases and genes to CHST11 Antibody (NBP2-30481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST11 Antibody (NBP2-30481)

Discover more about diseases related to CHST11 Antibody (NBP2-30481).
 

Pathways for CHST11 Antibody (NBP2-30481)

View related products by pathway.

PTMs for CHST11 Antibody (NBP2-30481)

Learn more about PTMs related to CHST11 Antibody (NBP2-30481).

Blogs on CHST11

There are no specific blogs for CHST11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHST11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST11
Uniprot