CHST11 Antibody

Immunocytochemistry/Immunofluorescence: CHST11 Antibody [NBP2-30481] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CHST11 Antibody [NBP2-30481] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

CHST11 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLK
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHST11 Antibody

• C4S-1
• C4ST
• C4ST-1
• C4ST1EC 2.8.2.5
• carbohydrate (chondroitin 4) sulfotransferase 11
• carbohydrate sulfotransferase 11
• Chondroitin 4-O-sulfotransferase 1
• Chondroitin 4-sulfotransferase 1
• DKFZp667A035
• FLJ41682
• HSA269537
• IgH/CHST11 fusion

Background

Chondroitin 4-sulfotransferases, such as CHST11, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate to position 4 of N-acetylgalactosamine residues in chondroitin (Yamauchi et al., 2000 [PubMed 10722746]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHST11
• Uniprot:
  • Q9NPF2(Human)