![Immunocytochemistry/Immunofluorescence: CHST11 Antibody [NBP2-30481] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CHST11-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30481-img0003.jpg "Immunocytochemistry/Immunofluorescence: CHST11 Antibody [NBP2-30481] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLK |
| Predicted Species | Mouse (94%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHST11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CHST11 Antibody (NBP2-30481)Discover more about diseases related to CHST11 Antibody (NBP2-30481).
| Pathways for CHST11 Antibody (NBP2-30481)View related products by pathway.
|
PTMs for CHST11 Antibody (NBP2-30481)Learn more about PTMs related to CHST11 Antibody (NBP2-30481).
| Research Areas for CHST11 Antibody (NBP2-30481)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CHST11 Antibody [NBP2-30481] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/CHST11-Antibody-Immunohistochemistry-Paraffin-NBP2-30481-img0001.jpg "Immunohistochemistry-Paraffin: CHST11 Antibody [NBP2-30481] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.")
-Western-Blot-NBP2-43648-img0008.jpg)
-Western-Blot-NBP2-43648-img0010.jpg)
-Western-Blot-NBP2-43648-img0013.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053..jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")