Chondromodulin-1/LECT1 Recombinant Protein Antigen

Images

 
There are currently no images for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Chondromodulin-1/LECT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LECT1.

Source: E. coli

Amino Acid Sequence: NGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNMD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chondromodulin-1/LECT1 Recombinant Protein Antigen

  • BRICD3
  • BRICHOS domain containing 3
  • ChM-1
  • CHM1chondromodulin I
  • CHMI
  • CHM-I
  • chondromodulin
  • Chondromodulin1
  • Chondromodulin-1
  • chondromodulin-I
  • LECT1
  • leukocyte cell derived chemotaxin 1
  • Leukocyte cell-derived chemotaxin 1
  • multiple myeloma tumor suppressor 1
  • MYETS1

Background

LECT1 encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
NBP2-49189
Species: Hu
Applications: IHC,  IHC-P
233-FB
Species: Hu
Applications: BA
NB100-56461
Species: Hu
Applications: ICC/IF, Simple Western, WB
NBP2-01632
Species: Hu
Applications: IHC,  IHC-P, WB
MAB289
Species: Hu
Applications: Simple Western, WB
DMP900
Species: Hu
Applications: ELISA
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DTSP10
Species: Hu
Applications: ELISA
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
AF4256
Species: Hu
Applications: WB
DM1300
Species: Hu
Applications: ELISA
243-B3
Species: Hu
Applications: BA
NBP1-84484PEP
Species: Hu
Applications: AC

Publications for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP) (0)

There are no publications for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP) (0)

There are no reviews for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chondromodulin-1/LECT1 Products

Research Areas for Chondromodulin-1/LECT1 Protein (NBP1-84484PEP)

Find related products by research area.

Blogs on Chondromodulin-1/LECT1

There are no specific blogs for Chondromodulin-1/LECT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chondromodulin-1/LECT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CNMD