CHMP2A Antibody - Azide and BSA Free

Western Blot: CHMP2A Antibody [H00027243-B01P] - Analysis of CHMP2A expression in transfected 293T cell line by CHMP2A polyclonal antibody. Lane 1: CHMP2A transfected lysate(24.42 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CHMP2A Antibody - Azide and BSA Free Summary

• Immunogen: CHMP2A (AAH02502, 1 a.a. - 222 a.a.) full-length human protein. MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
• Specificity: CHMP2A - chromatin modifying protein 2A,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CHMP2A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHMP2A Antibody - Azide and BSA Free

• BC-2
• BC2VPS2 homolog A
• CHMP2a
• CHMP2hVps2-1
• chromatin modifying protein 2A
• Chromatin-modifying protein 2a
• Putative breast adenocarcinoma marker BC-2
• Vacuolar protein sorting-associated protein 2-1
• vps2-1
• VPS2Aputative breast adenocarcinoma marker (32kD)
• VPS2charged multivesicular body protein 2a

Background

CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHMP2A
• Entrez:
  • 27243(Human)
• Uniprot:
  • AAH02502(Human)