CHD1L Antibody

Western Blot: CHD1L Antibody [NBP1-89154] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CHD1L antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89154] - Staining of human cerebral cortex, lower gastrointestinal, skin and testis using Anti-CHD1L antibody NBP1-89154 (A) shows similar protein distribution across tissues to independent antibody.

Immunocytochemistry/Immunofluorescence: CHD1L Antibody [NBP1-89154] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89154] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89154] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89154] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89154] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Discontinued

CHD1L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHD1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHD1L Antibody

• ALC1
• amplified in liver cancer 1
• amplified in liver cancer protein 1
• CHD1L
• CHDL
• chromodomain helicase DNA binding protein 1-like
• chromodomain-helicase-DNA-binding protein 1-like
• FLJ22530

Background

In response to DNA strand breaks, chromatin adopts a relaxed structure due to the addition of poly(ADP-ribose) (PAR) to chromatin proteins by PARP enzymes (see PARP1; MIM 173870), and this relaxation facilitates the repair of DNA damage. CHD1L interacts with PAR and has a role in chromatin relaxation following DNA damage (Ahel et al., 2009 (PubMed 19661379)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD1L