CEP63 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP63. Peptide sequence: YEKLQKKQMREFRGNTKNHREDRSEIERLTAKIEEFRQKSLDWEKQRLIY The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CEP63 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for CEP63 Antibody - BSA Free
Background
The CEP63 gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneousorganelle that functions as the major microtubule-organizing center in animal cells. Several alternatively splicedtranscript variants ha
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Publications for CEP63 Antibody (NBP2-84655) (0)
There are no publications for CEP63 Antibody (NBP2-84655).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CEP63 Antibody (NBP2-84655) (0)
There are no reviews for CEP63 Antibody (NBP2-84655).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CEP63 Antibody (NBP2-84655) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CEP63 Products
Research Areas for CEP63 Antibody (NBP2-84655)
Find related products by research area.
|
Blogs on CEP63