CEP290 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CEP290 Antibody [NBP2-57104] - Staining of human cell line RH-30 shows localization to centrosome. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEP290 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIPSLERLVNAIESKNAEGIFDASLHLKAQVDQLTGRNEELRQELRESRKEAINYSQQLAKANLKIDHLEKETSLLRQSEGSNVVFKGIDLPDGIAPSSASII
Specificity
Specificity of human CEP290 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP290
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP290 Recombinant Protein Antigen (NBP2-57104PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CEP290 Antibody

  • BBS14Bardet-Biedl syndrome 14 protein
  • Cancer/testis antigen 87
  • centrosomal protein 290kDa
  • Cep290
  • CT87JBTS6
  • FLJ13615
  • JBTS5CTCL tumor antigen se2-2
  • KIAA0373FLJ21979
  • LCA10monoclonal 3H11 antigen
  • MKS4
  • Nephrocystin-6
  • NPHP6centrosomal protein of 290 kDa
  • POC3 centriolar protein homolog
  • POC3
  • prostate cancer antigen T21
  • rd16,3H11AG
  • SLSN6nephrocytsin-6,3H11Ag
  • Tumor antigen se2-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88692
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, CyTOF-ready, IF
NBP2-98647
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-53232
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP2-14126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP2-56113
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47626
Species: Hu
Applications: ELISA, IHC, IHC-P, PEP-ELISA
H00145226-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57104
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for CEP290 Antibody (NBP2-57104) (0)

There are no publications for CEP290 Antibody (NBP2-57104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP290 Antibody (NBP2-57104) (0)

There are no reviews for CEP290 Antibody (NBP2-57104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CEP290 Antibody (NBP2-57104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CEP290 Products

Bioinformatics Tool for CEP290 Antibody (NBP2-57104)

Discover related pathways, diseases and genes to CEP290 Antibody (NBP2-57104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP290 Antibody (NBP2-57104)

Discover more about diseases related to CEP290 Antibody (NBP2-57104).
 

Pathways for CEP290 Antibody (NBP2-57104)

View related products by pathway.

PTMs for CEP290 Antibody (NBP2-57104)

Learn more about PTMs related to CEP290 Antibody (NBP2-57104).
 

Research Areas for CEP290 Antibody (NBP2-57104)

Find related products by research area.

Blogs on CEP290.

LAMP2: Protector of the lysosome
LAMP2 belongs to the family of membrane glycoproteins who confer selectins with carbohydrate ligands. LAMP2 has been implicated in tumor cell metastasis, as well as overall protection, maintenance, and adhesion of the lysosome. It appears that LAMP2 m...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP290 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP290