CEP164 Antibody - BSA Free

Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.

Immunocytochemistry/Immunofluorescence: CEP164 Antibody [NBP1-81445] - Staining of human cell line U-2 OS shows localization to centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human bronchus shows moderate to strong positivity in cilia in respiratory epithelial cells.

Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human nasopharynx shows strong positivity in cilia in respiratory epithelial cells.

Immunohistochemistry-Paraffin: CEP164 Antibody [NBP1-81445] - Staining of human endometrium shows strong positivity in cilia in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEP164 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
• Marker: Centriole Appendage Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP164
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEP164 Protein (NBP1-81445PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CEP164 Antibody - BSA Free

• centrosomal protein 164kDa
• FLJ54767

Background

Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEP164 Antibody (NBP1-81445)(19)

Publications using NBP1-81445

• Lee C, Tsai Y, Chen T et al. Prostaglandin E2 and Progesterone Receptor Coordinately Regulate Primary Cilia for Proper Decidualization The FASEB Journal 2025-08-07 [PMID: 40772309]
• Yung-Chieh Tsai, Tian-Ni Kuo, Ruei-Ci Lin, Hui-Ling Tsai, Yu-Ying Chao, Pei-Rong Lee, Ping-Jui Su, Chia-Yih Wang MicroRNA‑155‑5p inhibits trophoblast cell proliferation and invasion by disrupting centrosomal function Molecular Medicine Reports 2024-05-01 [PMID: 38551159]
• Lin RC, Chao YY, Su MT et al. Upregulation of miR-20b-5p inhibits trophoblast invasion by blocking autophagy in recurrent miscarriage Cellular signalling 2023-10-21 [PMID: 37871665] (Immunocytochemistry/ Immunofluorescence)
• Tsai YC, Kuo TN, Chao YY et al. PDGF-AA activates AKT and ERK signaling for testicular interstitial Leydig cell growth via primary cilia Journal of cellular biochemistry 2022-10-28 [PMID: 36306470]
• Chao Y, Huang B, Peng I et al. ATM- and ATR-Induced Primary Ciliogenesis Promotes Cisplatin Resistance in Pancreatic Ductal Adenocarcinoma Research Square 2021-12-02 [PMID: 36251015]
• An HL, Kuo HC, Tang TK Modeling Human Primary Microcephaly With hiPSC-Derived Brain Organoids Carrying CPAP-E1235V Disease-Associated Mutant Protein Frontiers in cell and developmental biology 2022-03-02 [PMID: 35309908]
• Teng Yn, Chang Hc, Chao Yy Et Al. Etoposide Triggers Cellular Senescence by Inducing Multiple Centrosomes and Primary Cilia in Adrenocortical Tumor Cells Cells 2021-06-11 [PMID: 34208028] (ICC/IF)
• Conduit SE, Davies EM, Fulcher AJ et al. Superresolution Microscopy Reveals Distinct Phosphoinositide Subdomains Within the Cilia Transition Zone Frontiers in Cell and Developmental Biology 2021-04-30 [PMID: 33996795] (Immunocytochemistry/ Immunofluorescence, Human)
• Chen TY, Huang BM, Tang TK, et al. Genotoxic stress-activated DNA-PK-p53 cascade and autophagy cooperatively induce ciliogenesis to maintain the DNA damage response Cell death and differentiation 2021-01-18 [PMID: 33462409] (WB, ICC/IF, Human)
• Chen TY, Lin TC, Kuo PL et al. Septin 7 is a centrosomal protein that ensures S phase entry and microtubule nucleation by maintaining the abundance of p150glued J. Cell. Physiol. 2020-09-01 [PMID: 32869310]
• Wang CY, Su MT, Cheng HL et al. Fetuin-A Inhibits Placental Cell Growth and Ciliogenesis in Gestational Diabetes Mellitus Int J Mol Sci 2019-10-21 [PMID: 31640125] (ICC/IF, Human)
• Colicino EG, Stevens K, Curtis E et al. Chromosome misalignment is associated with PLK1 activity at cenexin-positive mitotic centrosomes Mol. Biol. Cell [PMID: 31042116] (WB, ICC/IF, Zebrafish)
• Tsai, JJ;Hsu, WB;Liu, JH;Chang, CW;Tang, TK; CEP120 interacts with C2CD3 and Talpid3 and is required for centriole appendage assembly and ciliogenesis Sci Rep 2019-04-15 [PMID: 30988386] (ICC/IF, Human)
• Chen HY, Wu CT, Tang CC et al. Human microcephaly protein RTTN interacts with STIL and is required to build full-length centrioles Nat Commun 2017-08-15 [PMID: 28811500] (ICC/IF, Human)
• Karki M, Keyhaninejad N, Shuster CB. Precocious centriole disengagement and centrosome fragmentation induced by mitotic delay Nat Commun 2017-06-13 [PMID: 28607478] (ICC/IF, Human)
• Chang CW, Hsu WB, Tsai JJ et al. CEP295 interacts with microtubules and is required for centriole elongation. J. Cell. Sci. 2016-05-16 [PMID: 27185865] (ICC/IF, Human)
• Xavier G, Anne-Marie T, Iva U et al. Centrosomal nucleolin is required for microtubule network organization Cell Cycle. 2015-01-15 [PMID: 25590348] (ICC/IF, Human)
• Schueler M, Braun DA, Chandrasekar G et al. DCDC2 Mutations Cause a Renal-Hepatic Ciliopathy by Disrupting Wnt Signaling. Am J Hum Genet 2015-01-08 [PMID: 25557784] (ICC/IF, Human)
• Failler M, Gee HY, Krug P et al. Mutations of CEP83 Cause Infantile Nephronophthisis and Intellectual Disability. Am J Hum Genet 2014-06-05 [PMID: 24882706] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: CEP164
• Entrez:
  • 22897(Human)
• Uniprot:
  • Q9UPV0(Human)