CEBP gamma Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CEBP gamma Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEBPG.
  
  

  Source: E. coli

  Amino Acid Sequence: GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CEBPG
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89742.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEBP gamma Recombinant Protein Antigen

• c/EBP gamma
• CCAAT/enhancer binding protein (C/EBP), gamma
• CCAAT/enhancer-binding protein gamma
• GPE1BP
• IG/EBP-1

Background

The transcription factor C/EBP alpha (CCAAT-enhancer binding protein) is a heatstable, sequence-specific DNA-binding protein first purified from rat liver nuclei that binds avidly to several different cis-regulatory DNA sequences commonly associated with viral and cellular genes transcribed by RNA polymerase II. C/EBP alpha regulates gene expression in a variety of tissues including liver, adipose, lung and intestine. C/EBP alpha uses a bipartite structural motif to bind DNA. Two protein chains dimerize through a set of amphipathic alpha helices termed the leucine zipper. Highly basic polypeptide regions emerge from the zipper to form a linked set of DNA contact surfaces. C/EBP alpha appears to function exclusively in terminally differentiated, growth-arrested cells. Additional family members include C/EBP beta, C/EBP gamma,C/EBP delta and C/EBP episilon, all of which exhibit similar DNA-binding specificities and affinities to C/EBP alpha. Furthermore, C/EBP beta and C/EBP delta readily form heterodimers both with each other as well as with C/EBP alpha.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CEBPG