CEACAM6/CD66c Antibody (1G2)

Images

 
Immunocytochemistry/ Immunofluorescence: CEACAM-6/CD66c Antibody (1G2) [H00004680-M02] - Analysis of monoclonal antibody to CEACAM6 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: CEACAM6/CD66c Antibody (1G2) [H00004680-M02] - CEACAM-6/CD66c Antibody (1G2) [H00004680-M02] - Detection limit for recombinant GST tagged CEACAM6 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CEACAM6/CD66c Antibody (1G2) Summary

Immunogen
CEACAM6 (NP_002474.3 156 a.a. - 265 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CEACAM6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CEACAM6/CD66c Antibody (1G2)

  • carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific crossreacting antigen)
  • carcinoembryonic antigen-related cell adhesion molecule 6
  • CD66c antigen
  • CD66c
  • CEACAM6
  • CEACAM-6
  • CEAL
  • NCA
  • NCACEAL
  • Non-specific crossreacting antigen
  • Normal cross-reacting antigen

Background

CEA-related cell adhesion molecules (CEACAM) belong to the carcinoembryonic antigen (CEA) family. It consists of seven CEACAM (CEACAM 1, CEACAM 3-CEACAM 8) and 11 pregnancy-specific glycoprotein (PSG1-PSG11) members. The CEA family proteins belong to the immunoglobulin (Ig) superfamily and are composed of one Ig variable like (IgV) and a varying number (0-6) of Ig constant-like (IgC) domains. CEACAM molecules are membrane-bound either via a transmembrane domain or a glycosyl phosphatidyl inositol (GPI) anchor. CEACAM molecules are differentially expressed in epithelial cells or in leucocytes. Over-expression of CEA/CEACAM 5 in tumors of epithelial origin is the basis of its wide-spread use as a tumor marker. CEACAM 6 expression is strongly up-regulated already during early stages of adenocarcinoma formation e.g. in colon. The function of CEA family members varies widely: they function as cell adhesion molecules, tumor suppressors, regulators of lymphocyte and dendritic cell activation, receptors of Neisseria species and other bacteria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-77808
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB22441
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for CEACAM6/CD66c Antibody (H00004680-M02) (0)

There are no publications for CEACAM6/CD66c Antibody (H00004680-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM6/CD66c Antibody (H00004680-M02) (0)

There are no reviews for CEACAM6/CD66c Antibody (H00004680-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEACAM6/CD66c Antibody (H00004680-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEACAM6/CD66c Products

Bioinformatics Tool for CEACAM6/CD66c Antibody (H00004680-M02)

Discover related pathways, diseases and genes to CEACAM6/CD66c Antibody (H00004680-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEACAM6/CD66c Antibody (H00004680-M02)

Discover more about diseases related to CEACAM6/CD66c Antibody (H00004680-M02).
 

Pathways for CEACAM6/CD66c Antibody (H00004680-M02)

View related products by pathway.

PTMs for CEACAM6/CD66c Antibody (H00004680-M02)

Learn more about PTMs related to CEACAM6/CD66c Antibody (H00004680-M02).
 

Research Areas for CEACAM6/CD66c Antibody (H00004680-M02)

Find related products by research area.

Blogs on CEACAM6/CD66c

There are no specific blogs for CEACAM6/CD66c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEACAM6/CD66c Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM6
Entrez
Uniprot