CEACAM1/CD66a Recombinant Protein Antigen

Images

 
There are currently no images for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CEACAM1/CD66a Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEACAM3.

Source: E. coli

Amino Acid Sequence: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEACAM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85743.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEACAM1/CD66a Recombinant Protein Antigen

  • antigen CD66
  • BGP1
  • BGP-1
  • BGP1BGPBiliary glycoprotein 1
  • BGPI
  • Biliary Glycoprotein 1
  • biliary glycoprotein adhesion molecule
  • carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein)
  • carcinoembryonic antigen-related cell adhesion molecule 1
  • CD66a antigen
  • CD66a
  • Cea-1
  • CEACAM1
  • CEACAM-1
  • Hv-1
  • Hv-2
  • MHVR

Background

CEACAM1 encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89796
Species: Hu, Mu
Applications: IHC,  IHC-P
MAB7665
Species: Hu
Applications: IHC, WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P
AF4478
Species: Hu
Applications: IHC, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
MAB3934
Species: Hu
Applications: CyTOF-ready, Flow, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP1-85743PEP
Species: Hu
Applications: AC

Publications for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP) (0)

There are no publications for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP) (0)

There are no reviews for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEACAM1/CD66a Products

Research Areas for CEACAM1/CD66a Recombinant Protein Antigen (NBP1-85743PEP)

Find related products by research area.

Blogs on CEACAM1/CD66a

There are no specific blogs for CEACAM1/CD66a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CEACAM1/CD66a Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM1