CDR2 Recombinant Protein Antigen

Images

 
There are currently no images for CDR2 Protein (NBP1-84562PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDR2.

Source: E. coli

Amino Acid Sequence: GVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84562.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDR2 Recombinant Protein Antigen

  • CDR62
  • cerebellar degeneration-related protein (62kD)
  • cerebellar degeneration-related protein 2
  • cerebellar degeneration-related protein 2, 62kDa
  • Major Yo paraneoplastic antigen
  • Paraneoplastic cerebellar degeneration-associated antigen
  • PCD17
  • Yo paraneoplastic antigen
  • Yo

Background

CDR2 suppresses the transcriptional activity and DNA binding of nuclear factor-kappa B by an unknown mechanism. The neuron specific expression of CDR-2 is regulated by a post-transcriptional mechanism. CDR2 antibodies are useful tools for transcription regulation and neurology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57758
Species: Hu
Applications: ICC/IF
NBP2-02023
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00001109-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-86613
Species: Hu
Applications: IHC,  IHC-P, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-33506
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-84562PEP
Species: Hu
Applications: AC

Publications for CDR2 Protein (NBP1-84562PEP) (0)

There are no publications for CDR2 Protein (NBP1-84562PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDR2 Protein (NBP1-84562PEP) (0)

There are no reviews for CDR2 Protein (NBP1-84562PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDR2 Protein (NBP1-84562PEP). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for an antibody against human CDR2 to recognize thymic epithelial cells. You have several anti CDR2 antibodies. Are they against a thymic epithelial antigen or against the cerebellar degeneration-related protein 2, 62kDa?
    • Yes, the specific antibody you have inquired about is against cerebellar degeneration-related protein 2, 62 kDa. Moreover, all of our CDR2 primaries are against the same target.

Additional CDR2 Products

Research Areas for CDR2 Protein (NBP1-84562PEP)

Find related products by research area.

Blogs on CDR2.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDR2