Recombinant Human CDK5RAP1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CDK5RAP1 Protein [H00051654-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human CDK5RAP1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human CDK5RAP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLAAGPTFQHFLKSASAPQEKLSSEVEDPPPYLMMDELLGRQRKVYLETYGCQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CDK5RAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDK5RAP1 GST (N-Term) Protein

  • C20orf34
  • C42
  • CDK5 activator-binding protein C42
  • CDK5 regulatory subunit associated protein 1
  • CDK5 regulatory subunit-associated protein 1
  • CDK5RAP1.3
  • CDK5RAP1.4
  • CGI-05
  • chromosome 20 open reading frame 34
  • HSPC167

Background

CDK5RAP1 - CDK5 regulatory subunit associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1936
Species: Hu
Applications: IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
2037-C5/CF
Species: Hu
Applications: BA
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12295
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-86780
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-15952
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01) (0)

There are no publications for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01) (0)

There are no reviews for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDK5RAP1 Products

Bioinformatics Tool for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01)

Discover related pathways, diseases and genes to CDK5RAP1 Partial Recombinant Protein (H00051654-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01)

Discover more about diseases related to CDK5RAP1 Partial Recombinant Protein (H00051654-Q01).
 

Pathways for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01)

View related products by pathway.

PTMs for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01)

Learn more about PTMs related to CDK5RAP1 Partial Recombinant Protein (H00051654-Q01).
 

Research Areas for CDK5RAP1 Partial Recombinant Protein (H00051654-Q01)

Find related products by research area.

Blogs on CDK5RAP1

There are no specific blogs for CDK5RAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDK5RAP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK5RAP1