Recombinant Human CDK20 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CDK20 Protein [H00023552-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CDK20 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human CCRK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CDK20
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
55.99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00023552-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDK20 GST (N-Term) Protein

  • CAK-kinase p42
  • CCRKEC 2.7.11.22
  • CDCHP42
  • CDK-activating kinase p42
  • cell cycle related kinase
  • Cell cycle-related kinase
  • Cell division protein kinase 20
  • cyclin-dependent kinase 20
  • Cyclin-dependent protein kinase H
  • Cyclin-kinase-activating kinase p42
  • EC 2.7.11
  • p42
  • PNQALRE

Background

CCRK( AAH02655, 1 a.a. - 276 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-19985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-97510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03903
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB4640
Species: Hu
Applications: WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00023552-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CDK20 Recombinant Protein (H00023552-P01)(1)

Reviews for CDK20 Recombinant Protein (H00023552-P01) (0)

There are no reviews for CDK20 Recombinant Protein (H00023552-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK20 Recombinant Protein (H00023552-P01). (Showing 1 - 2 of 2 FAQ).

  1. Could you please let me know what was the expression system (E coli, insect cells,...?) of the CDK20 recombinant protein (H00023552-P01)?
    • This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system.
  2. What is the buffer composition of the product? I need the same buffer as a control for my experiment.
    • This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.

Other Available Formats

Additional CDK20 Products

Bioinformatics Tool for CDK20 Recombinant Protein (H00023552-P01)

Discover related pathways, diseases and genes to CDK20 Recombinant Protein (H00023552-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CDK20 Recombinant Protein (H00023552-P01)

Find related products by research area.

Blogs on CDK20

There are no specific blogs for CDK20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDK20 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK20