Recombinant Human CDK20 GST (N-Term) Protein

SDS-Page: Recombinant Human CDK20 Protein [H00023552-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human CDK20 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human CCRK
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CDK20
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 55.99 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDK20 GST (N-Term) Protein

• CAK-kinase p42
• CCRK
• CCRKEC 2.7.11.22
• CDCH
• CDCHP42
• CDK20
• CDK-activating kinase p42
• cell cycle related kinase
• Cell cycle-related kinase
• Cell division protein kinase 20
• cyclin-dependent kinase 20
• Cyclin-dependent protein kinase H
• Cyclin-kinase-activating kinase p42
• EC 2.7.11
• p42
• PNQALRE

Background

CCRK( AAH02655, 1 a.a. - 276 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CDK20 Recombinant Protein (H00023552-P01)(1)

Publication using H00023552-P01

• Feng H, Cheng ASL, Tsang DP et al. Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives [beta]-catenin/T cell factor-dependent hepatocarcinogenesis. . J. Clin. Invest. 1121(8):3159-3175. 2011-08-01 [PMID: 21747169]

FAQs for CDK20 Recombinant Protein (H00023552-P01). (Showing 1 - 2 of 2 FAQ).

1. Could you please let me know what was the expression system (E coli, insect cells, ...?) of the CDK20 recombinant protein (H00023552-P01)?
   • This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system (http://www.abnova.com/support/Protein.asp).
2. What is the buffer composition of the product? I need the same buffer as a control for my experiment.
   • This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.

Bioinformatics

• Gene Symbol: CDK20