CDK2 Recombinant Protein Antigen

Images

 
There are currently no images for CDK2 Recombinant Protein Antigen (NBP2-57327PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK2.

Source: E. coli

Amino Acid Sequence: PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57327.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDK2 Recombinant Protein Antigen

  • cdc2-related protein kinase
  • CDK2
  • cell devision kinase 2
  • Cell division protein kinase 2
  • cyclin-dependent kinase 2
  • EC 2.7.11
  • EC 2.7.11.22
  • p33 protein kinase
  • p33(CDK2)

Background

The protein encoded by the Cdk2 gene is a member of the Ser/Thr protein kinase family. This protein kinase is highlysimilar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of thecyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycleG1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex includingcyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its proteinphosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have beenreported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1555
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-90949
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-26876
Species: Hu
Applications: IHC,  IHC-P
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB7557
Species: Hu
Applications: IHC, WB

Publications for CDK2 Recombinant Protein Antigen (NBP2-57327PEP) (0)

There are no publications for CDK2 Recombinant Protein Antigen (NBP2-57327PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK2 Recombinant Protein Antigen (NBP2-57327PEP) (0)

There are no reviews for CDK2 Recombinant Protein Antigen (NBP2-57327PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDK2 Recombinant Protein Antigen (NBP2-57327PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDK2 Products

Research Areas for CDK2 Recombinant Protein Antigen (NBP2-57327PEP)

Find related products by research area.

Blogs on CDK2.

EZH1 has more to offer than gene repression
EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development.  Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2.  PR...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK2