CDCP2 Antibody

Images

 
Immunohistochemistry-Paraffin: SCUBE2 Antibody [NBP1-87438] - Staining of human kidney shows distinct membrane positivity in renal glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDCP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDCP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDCP2 Recombinant Protein Antigen (NBP1-87438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDCP2 Antibody

  • CUB Domain Containing Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000518-R01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-34980
Species: Hu
NBP2-14279
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91612
Species: Mu
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-93993
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01370
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87438
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CDCP2 Antibody (NBP1-87438) (0)

There are no publications for CDCP2 Antibody (NBP1-87438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDCP2 Antibody (NBP1-87438) (0)

There are no reviews for CDCP2 Antibody (NBP1-87438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDCP2 Antibody (NBP1-87438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDCP2 Products

CDCP2 NBP1-87438

Bioinformatics Tool for CDCP2 Antibody (NBP1-87438)

Discover related pathways, diseases and genes to CDCP2 Antibody (NBP1-87438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDCP2 Antibody (NBP1-87438)

Discover more about diseases related to CDCP2 Antibody (NBP1-87438).
 

Pathways for CDCP2 Antibody (NBP1-87438)

View related products by pathway.

Blogs on CDCP2

There are no specific blogs for CDCP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDCP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDCP2
Entrez
Uniprot