CDC42EP4 Antibody (3G10) - Azide and BSA Free

Western Blot: CDC42EP4 Antibody (3G10) [H00023580-M05] - Analysis of CDC42EP4 expression in transfected 293T cell line by CDC42EP4 monoclonal antibody (M05), clone 3G10. Lane 1: CDC42EP4 transfected lysate (Predicted MW: 38 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CDC42EP4 Antibody (3G10) - Azide and BSA Free Summary

• Immunogen: CDC42EP4 (NP_036253, 163 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM
• Specificity: CDC42EP4 - CDC42 effector protein (Rho GTPase binding) 4 (3G10)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDC42EP4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC42EP4 Antibody (3G10) - Azide and BSA Free

• BORG4MGC3740
• CDC42 effector protein (Rho GTPase binding) 4
• cdc42 effector protein 4
• CEP4Binder of Rho GTPases 4
• KAIA1777
• MGC17125

Background

The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42EP4
• Entrez:
  • 23580(Human)
• Uniprot:
  • NP_036253(Human)