CDC42BPG Antibody


Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining in human skin and liver tissues using anti-CDC42BPG antibody. Corresponding CDC42BPG RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CDC42BPG Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
Specificity of human CDC42BPG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
CDC42BPG Protein (NBP1-84072PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDC42BPG Antibody

  • CDC42 binding protein kinase gamma (DMPK-like)
  • CDC42-binding protein kinase gamma
  • DMPK2MRCK gamma
  • DMPK-like gamma
  • EC 2.7.11
  • EC
  • kappa-200
  • MRCKgamma
  • Myotonic dystrophy kinase-related CDC42-binding kinase gamma
  • myotonic dystrophy protein kinase like protein
  • Myotonic dystrophy protein kinase-like alpha
  • Myotonic dystrophy protein kinase-like gamma
  • serine/threonine-protein kinase MRCK gamma


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for CDC42BPG Antibody (NBP1-84072) (0)

There are no publications for CDC42BPG Antibody (NBP1-84072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42BPG Antibody (NBP1-84072) (0)

There are no reviews for CDC42BPG Antibody (NBP1-84072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC42BPG Antibody (NBP1-84072). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration of this antibody?
    • The concentration of Lot R27002 is 0.2 mg/ml. In our validation of CDC42BPG antibody [NBP1-84072] in Immunocytochemistry/Immunofluorescence application, human U-2 OS cell line was employed. Cells were fixed in 4% paraformaldehyde and Triton X-100 was used for permeabilization step in the protocol. This antibody worked well at 1-4 ug/ml concentration, which is 1:50-1:200 dilution. Please find our detailed Immunocytochemistry Protocol at this link.

Secondary Antibodies


Isotype Controls

Additional CDC42BPG Products

Bioinformatics Tool for CDC42BPG Antibody (NBP1-84072)

Discover related pathways, diseases and genes to CDC42BPG Antibody (NBP1-84072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CDC42BPG Antibody (NBP1-84072)

Find related products by research area.

Blogs on CDC42BPG

There are no specific blogs for CDC42BPG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDC42BPG Antibody and receive a gift card or discount.


Gene Symbol CDC42BPG