CDC42BPG Antibody

Images

 
Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining of human skin shows strong cytoplasmic in keratinocytes in superficial layers.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42BPG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42BPG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
CDC42BPG Protein (NBP1-84072PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42BPG Antibody

  • CDC42 binding protein kinase gamma (DMPK-like)
  • CDC42-binding protein kinase gamma
  • DMPK2MRCK gamma
  • DMPK-like gamma
  • EC 2.7.11
  • EC 2.7.11.1
  • HSMDPKIN
  • kappa-200
  • MRCKgamma
  • Myotonic dystrophy kinase-related CDC42-binding kinase gamma
  • myotonic dystrophy protein kinase like protein
  • Myotonic dystrophy protein kinase-like alpha
  • Myotonic dystrophy protein kinase-like gamma
  • serine/threonine-protein kinase MRCK gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
MAB6799
Species: Hu
Applications: WB, IHC
NB300-829
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00009578-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88050
Species: Hu
Applications: IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84072
Species: Hu
Applications: IHC, IHC-P

Publications for CDC42BPG Antibody (NBP1-84072) (0)

There are no publications for CDC42BPG Antibody (NBP1-84072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42BPG Antibody (NBP1-84072) (0)

There are no reviews for CDC42BPG Antibody (NBP1-84072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CDC42BPG Antibody (NBP1-84072). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration of this antibody?
    • The concentration of Lot R27002 is 0.2 mg/ml. In our validation of CDC42BPG antibody [NBP1-84072] in Immunocytochemistry/Immunofluorescence application, human U-2 OS cell line was employed. Cells were fixed in 4% paraformaldehyde and Triton X-100 was used for permeabilization step in the protocol. This antibody worked well at 1-4 ug/ml concentration, which is 1:50-1:200 dilution. Please find our detailed Immunocytochemistry Protocol at this link.

Secondary Antibodies

 

Isotype Controls

Additional CDC42BPG Products

Bioinformatics Tool for CDC42BPG Antibody (NBP1-84072)

Discover related pathways, diseases and genes to CDC42BPG Antibody (NBP1-84072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CDC42BPG Antibody (NBP1-84072)

Find related products by research area.

Blogs on CDC42BPG

There are no specific blogs for CDC42BPG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42BPG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPG