CDC42BPG Antibody - BSA Free

Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining of human skin shows high expression.

Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: CDC42BPG Antibody [NBP1-84072] - Staining in human skin and liver tissues using anti-CDC42BPG antibody. Corresponding CDC42BPG RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDC42BPG Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC42BPG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  CDC42BPG Protein (NBP1-84072PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDC42BPG Antibody - BSA Free

• CDC42 binding protein kinase gamma (DMPK-like)
• CDC42-binding protein kinase gamma
• DMPK2MRCK gamma
• DMPK-like gamma
• EC 2.7.11
• EC 2.7.11.1
• HSMDPKIN
• kappa-200
• MRCKgamma
• Myotonic dystrophy kinase-related CDC42-binding kinase gamma
• myotonic dystrophy protein kinase like protein
• Myotonic dystrophy protein kinase-like alpha
• Myotonic dystrophy protein kinase-like gamma
• serine/threonine-protein kinase MRCK gamma

Background

CDC42BPG - CDC42 binding protein kinase gamma (DMPK-like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for CDC42BPG Antibody (NBP1-84072). (Showing 1 - 1 of 1 FAQ).

1. What is the concentration of this antibody?
   • The concentration of Lot R27002 is 0.2 mg/ml. In our validation of CDC42BPG antibody [NBP1-84072] in Immunocytochemistry/Immunofluorescence application, human U-2 OS cell line was employed. Cells were fixed in 4% paraformaldehyde and Triton X-100 was used for permeabilization step in the protocol. This antibody worked well at 1-4 ug/ml concentration, which is 1:50-1:200 dilution. Please find our detailed Immunocytochemistry Protocol at this link.

Bioinformatics

• Gene Symbol: CDC42BPG