Recombinant Human CDC40 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CDC40 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-579 of Human CDC40 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CDC40

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC40 Protein

  • cell division cycle 40 homolog (S. cerevisiae)
  • cell division cycle 40 homolog (yeast)
  • Cell division cycle 40 homolog
  • Ehb3
  • EH-binding protein 3
  • hPRP17
  • MGC102802
  • pre-mRNA splicing factor 17
  • pre-mRNA-processing factor 17
  • PRP17 homolog
  • PRP17EHB3PRPF17FLJ10564

Background

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46033
Species: Hu
Applications: WB, IHC
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00056949-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-81865
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CDC40 Recombinant Protein (H00051362-P01) (0)

There are no publications for CDC40 Recombinant Protein (H00051362-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC40 Recombinant Protein (H00051362-P01) (0)

There are no reviews for CDC40 Recombinant Protein (H00051362-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC40 Recombinant Protein (H00051362-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC40 Products

Bioinformatics Tool for CDC40 Recombinant Protein (H00051362-P01)

Discover related pathways, diseases and genes to CDC40 Recombinant Protein (H00051362-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC40 Recombinant Protein (H00051362-P01)

Discover more about diseases related to CDC40 Recombinant Protein (H00051362-P01).
 

Pathways for CDC40 Recombinant Protein (H00051362-P01)

View related products by pathway.

PTMs for CDC40 Recombinant Protein (H00051362-P01)

Learn more about PTMs related to CDC40 Recombinant Protein (H00051362-P01).

Blogs on CDC40

There are no specific blogs for CDC40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATP7b Antibody
NB100-360
CDC40 Antibody
NBP2-58541

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDC40 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC40