We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CDC40 Recombinant Protein Antigen

Images

 
There are currently no images for CDC40 Recombinant Protein Antigen (NBP2-58541PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC40 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC40.

Source: E. coli

Amino Acid Sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC40
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58541.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC40 Recombinant Protein Antigen

  • cell division cycle 40 homolog (S. cerevisiae)
  • cell division cycle 40 homolog (yeast)
  • Cell division cycle 40 homolog
  • Ehb3
  • EH-binding protein 3
  • hPRP17
  • MGC102802
  • pre-mRNA splicing factor 17
  • pre-mRNA-processing factor 17
  • PRP17 homolog
  • PRP17EHB3PRPF17FLJ10564

Background

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP1-92297
Species: Hu, Mu, Rt
Applications:  IHC-P, WB
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89343
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16440
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85720
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-35253
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-07622
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46033
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31758
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00056949-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-88523
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81865
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no publications for CDC40 Recombinant Protein Antigen (NBP2-58541PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no reviews for CDC40 Recombinant Protein Antigen (NBP2-58541PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC40 Recombinant Protein Antigen (NBP2-58541PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC40 Products

Research Areas for CDC40 Recombinant Protein Antigen (NBP2-58541PEP)

Find related products by research area.

Blogs on CDC40

There are no specific blogs for CDC40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC40 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC40