CDC37L1 Antibody - BSA Free

Western Blot: CDC37L1 Antibody [NBP1-91772] - Analysis in control (vector only transfected HEK293T lysate) and CDC37L1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: CDC37L1 Antibody [NBP1-91772] - Staining of human cell line SiHa shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CDC37L1 Antibody [NBP1-91772] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Analysis in control (vector only transfected HEK293T lysate) and CDC37L1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDC37L1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHNSESLDQEHAKAQTAVSELRQREEEWRQKEEALVQREKMCLWSTDAISKDVFNKSFINQDKRKDTEDEDKSE
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC37L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDC37L1 Protein (NBP1-91772PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDC37L1 Antibody - BSA Free

• CDC37 cell division cycle 37 homolog (S. cerevisiae)-like 1
• CDC37BHARCCDC37 cell division cycle 37 homolog-like 1
• cell division cycle 37 homolog (S. cerevisiae)-like 1
• FLJ20639
• hsp90 co-chaperone Cdc37-like 1
• Hsp90-associating relative of Cdc37

Background

CDC37L1 is a cytoplasmic phosphoprotein that exists in complex with HSP90 (HSPCA; MIM 140571) as well as several other proteins involved in HSP90-mediated protein folding (Scholz et al., 2001 (PubMed 11413142)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC37L1