CDC2L6 Antibody

Images

 
Western Blot: CDC2L6 Antibody [NBP1-90034] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: CDC2L6 Antibody [NBP1-90034] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Western Blot: CDC2L6 Antibody [NBP1-90034] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: CDC2L6 Antibody [NBP1-90034] - Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CDC2L6 Antibody [NBP1-90034] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CDC2L6 Antibody [NBP1-90034] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Simple Western: CDC2L6 Antibody [NBP1-90034] - Simple Western lane view shows a specific band for CDC2L6 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: CDC2L6 Antibody [NBP1-90034] - Electropherogram image(s) of corresponding Simple Western lane view. CDC2L6 antibody was used at 1:25 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC2L6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
CDC2L6 Protein (NBP1-90034PEP)
Publications
Read Publications using
NBP1-90034 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    3 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23749998).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC2L6 Antibody

  • bA346C16.3
  • CDC2L6
  • CDC2-related protein kinase 6
  • CDK8-like cyclin-dependent kinase
  • cell division cycle 2-like 6 (CDK8-like)
  • Cell division cycle 2-like protein kinase 6
  • Cell division protein kinase 19
  • cyclin-dependent kinase (CDC2-like) 11
  • Cyclin-dependent kinase 11
  • cyclin-dependent kinase 19
  • Death-preventing kinase
  • EC 2.7.11
  • EC 2.7.11.22
  • KIAA1028CDK11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NB100-495
Species: Hu
Applications: WB
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58498
Species: Hu
Applications: ICC/IF
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CDC2L6 Antibody (NBP1-90034)(3)

Reviews for CDC2L6 Antibody (NBP1-90034) (0)

There are no reviews for CDC2L6 Antibody (NBP1-90034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDC2L6 Antibody (NBP1-90034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC2L6 Products

Bioinformatics Tool for CDC2L6 Antibody (NBP1-90034)

Discover related pathways, diseases and genes to CDC2L6 Antibody (NBP1-90034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2L6 Antibody (NBP1-90034)

Discover more about diseases related to CDC2L6 Antibody (NBP1-90034).
 

Pathways for CDC2L6 Antibody (NBP1-90034)

View related products by pathway.

Research Areas for CDC2L6 Antibody (NBP1-90034)

Find related products by research area.

Blogs on CDC2L6

There are no specific blogs for CDC2L6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2L6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK19