CDC2L6 Antibody

Product Discontinued

CDC2L6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK19
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
  • Immunoprecipitation
  • Knockdown Validated
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Chip reactivity reported in (PMID:23749998). IP reactivity reported in (PMID:25344755). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23749998). Mouse reactivity reported in the scientific literature (PMID: 25344755)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDC2L6 Antibody

• bA346C16.3
• CDC2L6
• CDC2-related protein kinase 6
• CDK19
• CDK8-like cyclin-dependent kinase
• cell division cycle 2-like 6 (CDK8-like)
• Cell division cycle 2-like protein kinase 6
• Cell division protein kinase 19
• cyclin-dependent kinase (CDC2-like) 11
• Cyclin-dependent kinase 11
• cyclin-dependent kinase 19
• Death-preventing kinase
• EC 2.7.11
• EC 2.7.11.22
• KIAA1028
• KIAA1028CDK11

Background

CDC2L6 encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDC2L6 Antibody (NBP1-90034)(3)

Publications using NBP1-90034

• Pelish HE, Liau BB, Nitulescu II et al. Mediator kinase inhibition further activates super-enhancer-associated genes in AML. Nature 2015-10-08 [PMID: 26416749] (WB, Human)
• Li N, Fassl A, Chick J et al. Cyclin C is a haploinsufficient tumor suppressor. Nat Cell Biol 2014-11-01 [PMID: 25344755] (IP, WB, Mouse)
• Tsutsui T, Fukasawa R, Shinmyouzu K et al. Mediator Complex Recruits Epigenetic Regulators via Its Two Cyclin-dependent Kinase Subunits to Repress Transcription of Immune Response Genes. J Biol Chem 2013-07-19 [PMID: 23749998] (Chemotaxis, WB, Human)

Bioinformatics

• Gene Symbol: CDK19