We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CDC2L5 Recombinant Protein Antigen

Images

 
There are currently no images for CDC2L5 Protein (NBP2-34123PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CDC2L5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDK13.

Source: E. coli

Amino Acid Sequence: PLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDK13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34123.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDC2L5 Recombinant Protein Antigen

  • CDC2L
  • CDC2L5
  • CDC2LEC 2.7.11.22
  • CDC2-related protein kinase 5
  • CDK13
  • Cell division cycle 2-like protein kinase 5
  • Cell division protein kinase 13
  • CHED
  • CHEDcell division cycle 2-like 5 (cholinesterase-related cell division controller)
  • Cholinesterase-related cell division controller
  • cyclin-dependent kinase 13
  • EC 2.7.11
  • EC 2.7.11.23
  • hCDK13
  • KIAA1791
  • KIAA1791FLJ35215

Background

CDC2L5 is encoded by this gene is a member of the cyclin-dependent serine/threonine protein kinase family. Members of this family are well known for their essential roles as master switches in cell cycle control. Some of the cell cycle control kinases are able to phosphorylate proteins that are important for cell differentiation and apoptosis, thus provide connections between cell proliferation, differentiation, and apoptosis. Proteins of this family may also be involved in non-cell cycle-related functions, such as neurocytoskeleton dynamics. The exact function of this protein has not yet been determined. It has unusually large N- and C-termini and is ubiquitously expressed in many tissues. Two alternatively spliced variants are described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-87011
Species: Hu
Applications: IP, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46156
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-496
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-101
Species: Bv, Eq, Hu, Mu
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-92609
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-06519
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-88089
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
1726-JG
Species: Hu
Applications: BA
H00057018-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB

Publications for CDC2L5 Protein (NBP2-34123PEP) (0)

There are no publications for CDC2L5 Protein (NBP2-34123PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2L5 Protein (NBP2-34123PEP) (0)

There are no reviews for CDC2L5 Protein (NBP2-34123PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDC2L5 Protein (NBP2-34123PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC2L5 Products

Array NBP2-34123PEP

Research Areas for CDC2L5 Protein (NBP2-34123PEP)

Find related products by research area.

Blogs on CDC2L5

There are no specific blogs for CDC2L5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDC2L5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK13