CDC2L2 Partial Protein

Images

 
SDS-Page: CDC2L2 Partial Protein [H00728642-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

CDC2L2 Partial Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 681-780 of Human CDC2L2

Source: Wheat Germ

Amino Acid Sequence: GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Protein
Gene
CDK11A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC2L2 Partial Protein

  • CDK11-p110
  • CDK11-p58
  • cyclin-dependent kinase 11A
  • PITSLRE protein kinase beta

Background

CDC2L2 - cell division cycle 2-like 2 (PITSLRE proteins)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-495
Species: Hu
Applications: WB, IP
NBP2-64704
Species: Hu
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47542
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58498
Species: Hu
Applications: ICC/IF
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-87132
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89698
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39057
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CDC2L2 Partial Recombinant Protein (H00728642-Q01) (0)

There are no publications for CDC2L2 Partial Recombinant Protein (H00728642-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2L2 Partial Recombinant Protein (H00728642-Q01) (0)

There are no reviews for CDC2L2 Partial Recombinant Protein (H00728642-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC2L2 Partial Recombinant Protein (H00728642-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC2L2 Products

Bioinformatics Tool for CDC2L2 Partial Recombinant Protein (H00728642-Q01)

Discover related pathways, diseases and genes to CDC2L2 Partial Recombinant Protein (H00728642-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2L2 Partial Recombinant Protein (H00728642-Q01)

Discover more about diseases related to CDC2L2 Partial Recombinant Protein (H00728642-Q01).
 

Pathways for CDC2L2 Partial Recombinant Protein (H00728642-Q01)

View related products by pathway.

PTMs for CDC2L2 Partial Recombinant Protein (H00728642-Q01)

Learn more about PTMs related to CDC2L2 Partial Recombinant Protein (H00728642-Q01).
 

Research Areas for CDC2L2 Partial Recombinant Protein (H00728642-Q01)

Find related products by research area.

Blogs on CDC2L2

There are no specific blogs for CDC2L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CDC2L2 Antibody
NB100-496

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2L2 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK11A