CD84/SLAMF5 Recombinant Protein Antigen

Images

 
There are currently no images for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD84/SLAMF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD84/SLAMF5.

Source: E. coli

Amino Acid Sequence: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD84
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49635.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD84/SLAMF5 Recombinant Protein Antigen

  • CD84 antigen (leukocyte antigen)
  • CD84 antigen
  • CD84 molecule
  • CD84
  • Cell surface antigen MAX.3
  • DKFZp781E2378
  • hCD84
  • hly9-beta
  • leucocyte differentiation antigen CD84
  • leukocyte antigen CD84
  • Leukocyte differentiation antigen CD84
  • Ly-9B
  • mCD84
  • Signaling lymphocytic activation molecule 5
  • SLAM family member 5
  • SLAMF5
  • SLAMF5LY9B

Background

CD84 is a 64-82 kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. CD84 is expressed on mature B cells and B cell lines but not on plasma cell lines. Immunohistochemical studies demonstrate that it strongly stains tissue macrophages. It is also expressed on platelets and at low levels on blood T cells. Cellular expression does not significantly increase after activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
AF4330
Species: Mu
Applications: CyTOF-ready, Flow, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
AF1898
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF3327
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
AF1039
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
MAB19081
Species: Hu
Applications: CyTOF-ready, Flow
MPTX20
Species: Mu
Applications: ELISA
NBP2-45868
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
NBP3-45368
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-22542
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
MAB689
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
MAB356
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
NBP2-45549
Species: Hu
Applications: Flow, IHC,  IHC-P, WB

Publications for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP) (0)

There are no publications for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP) (0)

There are no reviews for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD84/SLAMF5 Products

Research Areas for CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP)

Find related products by research area.

Blogs on CD84/SLAMF5

There are no specific blogs for CD84/SLAMF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD84/SLAMF5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD84