CD84/SLAMF5 Antibody

Images

 
Western Blot: CD84/SLAMF5 Antibody [H00008832-B01P] - Analysis of CD84 expression in human spleen.
Western Blot: CD84/SLAMF5 Antibody [H00008832-B01P] - Analysis of CD84 expression in transfected 293T cell line by CD84 polyclonal antibody. Lane 1: CD84 transfected lysate(36.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD84/SLAMF5 Antibody Summary

Immunogen
CD84 (NP_003865.1, 1 a.a. - 328 a.a.) full-length human protein. MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Specificity
Reacts with CD84 molecule.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CD84
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD84/SLAMF5 Antibody

  • CD84 antigen (leukocyte antigen)
  • CD84 antigen
  • CD84 molecule
  • CD84
  • Cell surface antigen MAX.3
  • DKFZp781E2378
  • hCD84
  • hly9-beta
  • leucocyte differentiation antigen CD84
  • leukocyte antigen CD84
  • Leukocyte differentiation antigen CD84
  • Ly-9B
  • mCD84
  • Signaling lymphocytic activation molecule 5
  • SLAM family member 5
  • SLAMF5
  • SLAMF5LY9B

Background

Members of the CD2 (see MIM 186990) subgroup of the Ig superfamily, such as CD84, have similar patterns of conserved disulfide bonds and function in adhesion interactions between T lymphocytes and accessory cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu
Applications: WB, ELISA
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF3327
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP2-33733
Species: Hu
Applications: IHC, IHC-P
NBP2-22542
Species: Hu
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC

Publications for CD84/SLAMF5 Antibody (H00008832-B01P) (0)

There are no publications for CD84/SLAMF5 Antibody (H00008832-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD84/SLAMF5 Antibody (H00008832-B01P) (0)

There are no reviews for CD84/SLAMF5 Antibody (H00008832-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD84/SLAMF5 Antibody (H00008832-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD84/SLAMF5 Products

Bioinformatics Tool for CD84/SLAMF5 Antibody (H00008832-B01P)

Discover related pathways, diseases and genes to CD84/SLAMF5 Antibody (H00008832-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD84/SLAMF5 Antibody (H00008832-B01P)

Discover more about diseases related to CD84/SLAMF5 Antibody (H00008832-B01P).
 

Pathways for CD84/SLAMF5 Antibody (H00008832-B01P)

View related products by pathway.

PTMs for CD84/SLAMF5 Antibody (H00008832-B01P)

Learn more about PTMs related to CD84/SLAMF5 Antibody (H00008832-B01P).

Blogs on CD84/SLAMF5

There are no specific blogs for CD84/SLAMF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD84/SLAMF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD84
Entrez
Uniprot