CD74 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CD74 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD74.
  
  

  Source: E. coli

  Amino Acid Sequence: PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD74
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85225.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD74 Recombinant Protein Antigen

• CD74 antigen (invariant polypeptide of major histocompatibility complex, classII antigen-associated)
• CD74 antigen
• CD74 molecule, major histocompatibility complex, class II invariant chain
• CD74
• CLIP
• DHLAG
• DHLAGgamma chain of class II antigens
• HLA class II histocompatibility antigen gamma chain
• HLADG
• HLA-DR antigens-associated invariant chain
• HLA-DR-gamma
• Ia antigen-associated invariant chain
• Ia-associated invariant chain
• Ia-gamma
• Ii
• INVG34
• MHC HLA-DR gamma chain
• p33

Background

CD74, also known as the MHC class II associated invariant chain (Ii), is a type II transmembrane protein which binds to the peptide binding groove of newly synthesized MHC class II alpha/beta heterodimers and prevents their premature association with endogenous polypeptides. CD74 is produced in molar excess over MHC class II and some of this is expressed by an unknown pathway on the cell surface independent of, or in association with, MHC class II molecules. The half life of CD74 on the cell surface is only 3 to 4 min after which it is internalized. It has been proposed that cell surface CD74 binds MHC class II molecules which have lost their antigenic peptide leading to internalization and reloading with antigenic peptide. The transport route of class II alpha/beta/Ii complexes is regulated selectively by two forms of CD74 (p33 and p35) which are generated by the use of alternative translation initiation sites. CD74 is expressed primarily by antigen presenting cells such as B lymphocytes (from before the pre-B cell stage to before the plasma cell stage), macrophages and monocytes together, with many epithelial cells. CD74 may exist in different isoforms ranging in size from 33 to 41 kDa, depending on genetic splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD74