CD74 Recombinant Protein Antigen

Images

 
There are currently no images for CD74 Protein (NBP1-85225PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD74 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD74.

Source: E. coli

Amino Acid Sequence: PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD74
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85225.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD74 Recombinant Protein Antigen

  • CD74 antigen (invariant polypeptide of major histocompatibility complex, classII antigen-associated)
  • CD74 antigen
  • CD74 molecule, major histocompatibility complex, class II invariant chain
  • CD74
  • CLIP
  • DHLAG
  • DHLAGgamma chain of class II antigens
  • HLA class II histocompatibility antigen gamma chain
  • HLADG
  • HLA-DR antigens-associated invariant chain
  • HLA-DR-gamma
  • Ia antigen-associated invariant chain
  • Ia-associated invariant chain
  • Ia-gamma
  • Ii
  • INVG34
  • MHC HLA-DR gamma chain
  • p33

Background

CD74, also known as the MHC class II associated invariant chain (Ii), is a type II transmembrane protein which binds to the peptide binding groove of newly synthesized MHC class II alpha/beta heterodimers and prevents their premature association with endogenous polypeptides. CD74 is produced in molar excess over MHC class II and some of this is expressed by an unknown pathway on the cell surface independent of, or in association with, MHC class II molecules. The half life of CD74 on the cell surface is only 3 to 4 min after which it is internalized. It has been proposed that cell surface CD74 binds MHC class II molecules which have lost their antigenic peptide leading to internalization and reloading with antigenic peptide. The transport route of class II alpha/beta/Ii complexes is regulated selectively by two forms of CD74 (p33 and p35) which are generated by the use of alternative translation initiation sites. CD74 is expressed primarily by antigen presenting cells such as B lymphocytes (from before the pre-B cell stage to before the plasma cell stage), macrophages and monocytes together, with many epithelial cells. CD74 may exist in different isoforms ranging in size from 33 to 41 kDa, depending on genetic splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB289
Species: Hu
Applications: Simple Western, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
NBP1-89790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-34118
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for CD74 Protein (NBP1-85225PEP) (0)

There are no publications for CD74 Protein (NBP1-85225PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD74 Protein (NBP1-85225PEP) (0)

There are no reviews for CD74 Protein (NBP1-85225PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD74 Protein (NBP1-85225PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD74 Products

Research Areas for CD74 Protein (NBP1-85225PEP)

Find related products by research area.

Blogs on CD74.

CD74 - a central player in antigen presentation by MHC class II
Cluster of differentiation 74 (CD74) is an important integral membrane protein that serves as a chaperone for MHC class II molecules. CD74, also known as the invariant chain or Ii, is needed for the proper folding and trafficking of MHC class II in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD74 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD74