CD39L4/ENTPD5 Antibody (4A5)

Images

 
Western Blot: CD39L4/ENTPD5 Antibody (4A5) [H00000957-M07] - Analysis of ENTPD5 expression in HepG2 (Cat # L019V1).
ELISA: CD39L4/ENTPD5 Antibody (4A5) [H00000957-M07] - Detection limit for recombinant GST tagged ENTPD5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CD39L4/ENTPD5 Antibody (4A5) Summary

Immunogen
ENTPD5 (NP_001240 319 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Specificity
ENTPD5 (4A5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENTPD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD39L4/ENTPD5 Antibody (4A5)

  • CD39 antigen-like 4
  • CD39L4
  • CD39L4NTPDase 5
  • CD39-like 4
  • EC 3.6.1
  • EC 3.6.1.42
  • EC 3.6.1.6
  • ectonucleoside triphosphate diphosphohydrolase 5
  • ENTPD5
  • ER-UDPase
  • GDPase ENTPD5
  • Guanosine-diphosphatase ENTPD5
  • MGC163357
  • MGC163359
  • NTPDase 5
  • NTPDase-5
  • Nucleoside diphosphatase
  • Pcph proto-oncogene protein
  • PCPH
  • proto-oncogene CPH
  • UDPase ENTPD5
  • Uridine-diphosphatase ENTPD5

Background

ENTPD5 is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-80533
Species: Mu
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF4399
Species: Hu
Applications: WB, IP
NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81510
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4400
Species: Hu
Applications: WB, IHC
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00000957-M07
Species: Hu
Applications: WB, ELISA

Publications for CD39L4/ENTPD5 Antibody (H00000957-M07) (0)

There are no publications for CD39L4/ENTPD5 Antibody (H00000957-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD39L4/ENTPD5 Antibody (H00000957-M07) (0)

There are no reviews for CD39L4/ENTPD5 Antibody (H00000957-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD39L4/ENTPD5 Antibody (H00000957-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD39L4/ENTPD5 Products

Bioinformatics Tool for CD39L4/ENTPD5 Antibody (H00000957-M07)

Discover related pathways, diseases and genes to CD39L4/ENTPD5 Antibody (H00000957-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD39L4/ENTPD5 Antibody (H00000957-M07)

Discover more about diseases related to CD39L4/ENTPD5 Antibody (H00000957-M07).
 

Pathways for CD39L4/ENTPD5 Antibody (H00000957-M07)

View related products by pathway.

PTMs for CD39L4/ENTPD5 Antibody (H00000957-M07)

Learn more about PTMs related to CD39L4/ENTPD5 Antibody (H00000957-M07).
 

Research Areas for CD39L4/ENTPD5 Antibody (H00000957-M07)

Find related products by research area.

Blogs on CD39L4/ENTPD5

There are no specific blogs for CD39L4/ENTPD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD39L4/ENTPD5 Antibody (4A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD5
Entrez
OMIM
Uniprot