CD39L1/ENTPD2 Antibody - Azide and BSA Free Summary
| Immunogen |
ENTPD2 (ABM86549.1, 1 a.a. - 495 a.a.) full-length human protein. MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
ENTPD2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CD39L1/ENTPD2 Antibody - Azide and BSA Free
Background
ENTPD2 is encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po
Applications: IHC, IHC-P
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Publications for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug) (0)
There are no publications for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug) (0)
There are no reviews for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD39L1/ENTPD2 Products
Array H00000954-B01P-50ug
Research Areas for CD39L1/ENTPD2 Antibody (H00000954-B01P-50ug)
Find related products by research area.
|
Blogs on CD39L1/ENTPD2