CD300a/LMIR1 Recombinant Protein Antigen

Images

 
There are currently no images for CD300a/LMIR1 Protein (NBP1-84431PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD300a/LMIR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300A.

Source: E. coli

Amino Acid Sequence: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD300A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84431.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD300a/LMIR1 Recombinant Protein Antigen

  • CD300a antigenCMRF35H9
  • CD300a molecule
  • CD300a
  • CLM8
  • CLM-8
  • CMRF35H leukocyte immunoglobulin-like receptor
  • CMRF-35H
  • CMRF35-H
  • CMRF35-H9
  • CMRF-35-H9CD300 antigen-like family member A
  • CMRF35HIRp60
  • CMRF35-like molecule 8
  • IGSF12
  • IGSF12NK inhibitory receptor
  • Immunoglobulin superfamily member 12
  • Inhibitory receptor protein 60
  • IRC1
  • IRC1/IRC2
  • IRC2
  • IRp60
  • leukocyte membrane antigen
  • LMIR1
  • MAIR-I
  • Mcipr1
  • NKRL
  • Pigr4

Background

Human CD300a, otherwise known as IRp60 (inhibitory receptor protein 60), is a 60kDa transmembrane glycoprotein expressed by natural killer cells (NK), T and B cell subsets, monocytes, neutrophils, macrophages, granulocytes, dendritic cells (DC) and mast cells. Studies have shown that the cross-linking of CD300a on NK results in a down-regulation of their cytolytic activity, whilst cross-linking of CD300a on mast cells, inhibits IgE-induced degranulation and SCF-mediated survival. Furthermore, cross-linking of CD300a on the surface of eosinophils has been shown to significantly inhibit their survival, chemotaxis and activation in response to certain inflammatory cytokines, whilst eosinophil-derived MBP (major basic protein) and EDN (neurotoxin), can down-regulate CD300a expression on mast cells in vitro.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
AF3256
Species: Hu
Applications: WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB666
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
MAB1059
Species: Hu
Applications: CyTOF-ready, Flow
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
7954-GM/CF
Species: Hu
Applications: BA
485-MI
Species: Mu
Applications: BA
M5000
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
AF1330
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, WB
NBP1-84431PEP
Species: Hu
Applications: AC

Publications for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)

There are no publications for CD300a/LMIR1 Protein (NBP1-84431PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)

There are no reviews for CD300a/LMIR1 Protein (NBP1-84431PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD300a/LMIR1 Products

Research Areas for CD300a/LMIR1 Protein (NBP1-84431PEP)

Find related products by research area.

Blogs on CD300a/LMIR1

There are no specific blogs for CD300a/LMIR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD300a/LMIR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD300A