CD300a/LMIR1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD300A. Source: E. coli
Amino Acid Sequence: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CD300A |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84431. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CD300a/LMIR1 Recombinant Protein Antigen
Background
Human CD300a, otherwise known as IRp60 (inhibitory receptor protein 60), is a 60kDa transmembrane glycoprotein expressed by natural killer cells (NK), T and B cell subsets, monocytes, neutrophils, macrophages, granulocytes, dendritic cells (DC) and mast cells. Studies have shown that the cross-linking of CD300a on NK results in a down-regulation of their cytolytic activity, whilst cross-linking of CD300a on mast cells, inhibits IgE-induced degranulation and SCF-mediated survival. Furthermore, cross-linking of CD300a on the surface of eosinophils has been shown to significantly inhibit their survival, chemotaxis and activation in response to certain inflammatory cytokines, whilst eosinophil-derived MBP (major basic protein) and EDN (neurotoxin), can down-regulate CD300a expression on mast cells in vitro.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: AC
Publications for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)
There are no publications for CD300a/LMIR1 Protein (NBP1-84431PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)
There are no reviews for CD300a/LMIR1 Protein (NBP1-84431PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CD300a/LMIR1 Protein (NBP1-84431PEP) (0)
Additional CD300a/LMIR1 Products
Research Areas for CD300a/LMIR1 Protein (NBP1-84431PEP)
Find related products by research area.
|
Blogs on CD300a/LMIR1