CD30/TNFRSF8 Recombinant Protein Antigen

Images

 
There are currently no images for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD30/TNFRSF8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD30/TNFRSF8

Source: E.coli

Amino Acid Sequence: QCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFRSF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21235. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD30/TNFRSF8 Recombinant Protein Antigen

  • CD30 antigen
  • CD30
  • CD30KI-1
  • CD30L receptor
  • cytokine receptor CD30
  • D1S166EKi-1
  • Ki-1 antigen
  • Lymphocyte activation antigen CD30
  • TNFRSF8
  • tumor necrosis factor receptor superfamily member 8
  • tumor necrosis factor receptor superfamily, member 8

Background

CD30 is a type I transmembrane protein and a member of the tumor necrosis factor receptor superfamily of proteins. (1,2) Murine CD30 is expressed predominantly in the thymus, and it is inducible in mouse splenocytes stimulated with pokeweed mitogen or concanavalin A. (1) In anti-CD3epsilon-activated spleen cells, CD30 is expressed primarily on the surface of CD8+ T cells with peak expression on days 4 and 5. Stimulation of CD30+ CTL lines with plate-bound anti-CD30 directly signals IL-5 but not IFN; production. (1) While these studies demonstrate that CD30 directs cytokine secretion and suggest that CD30 may play a pivotal role in the pattern of cytokine production by T cells, the precise roles of CD30 and its ligand (CD153) in T-cell development have not been clearly defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
AF1028
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DR2A00
Species: Hu
Applications: ELISA
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
H00003669-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
485-MI
Species: Mu
Applications: BA

Publications for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP) (0)

There are no publications for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP) (0)

There are no reviews for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD30/TNFRSF8 Products

Research Areas for CD30/TNFRSF8 Recombinant Protein Antigen (NBP3-21235PEP)

Find related products by research area.

Blogs on CD30/TNFRSF8.

Unlocking the Potential of Biosimilars in Immuno-Oncology
By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD30/TNFRSF8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF8