CD3 gamma Recombinant Protein Antigen

Images

 
There are currently no images for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD3 gamma Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD3G.

Source: E. coli

Amino Acid Sequence: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD3G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32636.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD3 gamma Recombinant Protein Antigen

  • CD3 gamma
  • CD3g antigen
  • CD3g antigen, gamma polypeptide (TiT3 complex)
  • CD3g molecule, epsilon (CD3-TCR complex)
  • CD3g molecule, gamma (CD3-TCR complex)
  • CD3g
  • CD3-GAMMA
  • FLJ17620
  • FLJ17664
  • FLJ79544
  • FLJ94613
  • IMD17
  • MGC138597
  • T3G
  • T-cell antigen receptor complex, gamma subunit of T3
  • T-cell receptor T3 gamma chain
  • T-cell surface glycoprotein CD3 gamma chain

Background

CD3G is encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
MAB7297
Species: Mu
Applications: CyTOF-reported, Flow
7268-CT
Species: Hu
Applications: BA
NBP2-76399
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, mIF, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
NBP2-33600
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-65543
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-32636PEP
Species: Hu
Applications: AC

Publications for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP) (0)

There are no publications for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP) (0)

There are no reviews for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 gamma Products

Research Areas for CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP)

Find related products by research area.

Blogs on CD3 gamma

There are no specific blogs for CD3 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD3 gamma Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3G