Recombinant Human CD160 Protein

Images

 
SDS-Page: Recombinant Human CD160 Protein [H00011126-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CD160 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-181 of Human CD160 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CD160
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD160 Protein

  • BY55
  • BY55FLJ46513
  • CD160 antigenimmunoglobulin superfamily member
  • CD160 molecule
  • CD160
  • Natural killer cell receptor BY55
  • NK1
  • NK28

Background

CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB7614
Species: Mu
Applications: Flow, CyTOF-ready
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for CD160 Recombinant Protein (H00011126-P02) (0)

There are no publications for CD160 Recombinant Protein (H00011126-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD160 Recombinant Protein (H00011126-P02) (0)

There are no reviews for CD160 Recombinant Protein (H00011126-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD160 Recombinant Protein (H00011126-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD160 Products

Bioinformatics Tool for CD160 Recombinant Protein (H00011126-P02)

Discover related pathways, diseases and genes to CD160 Recombinant Protein (H00011126-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD160 Recombinant Protein (H00011126-P02)

Discover more about diseases related to CD160 Recombinant Protein (H00011126-P02).
 

Pathways for CD160 Recombinant Protein (H00011126-P02)

View related products by pathway.

PTMs for CD160 Recombinant Protein (H00011126-P02)

Learn more about PTMs related to CD160 Recombinant Protein (H00011126-P02).
 

Research Areas for CD160 Recombinant Protein (H00011126-P02)

Find related products by research area.

Blogs on CD160

There are no specific blogs for CD160, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD160 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD160
Entrez