We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CD160 Antibody

Images

 
Western Blot: CD160 Antibody [H00011126-B01P] - Analysis of CD160 expression in human spleen.
Western Blot: CD160 Antibody [H00011126-B01P] - Analysis of CD160 expression in transfected 293T cell line by CD160 polyclonal antibody. Lane 1: CD160 transfected lysate(19.91 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related CD160 Primary Antibodies

Order Details


    • Catalog Number
      H00011126-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CD160 Antibody Summary

Immunogen
CD160 (AAH14465.1, 1 a.a. - 181 a.a.) full-length human protein. MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Specificity
CD160 - CD160 molecule,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CD160
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CD160 Antibody

  • BY55
  • BY55FLJ46513
  • CD160 antigenimmunoglobulin superfamily member
  • CD160 molecule
  • CD160
  • Natural killer cell receptor BY55
  • NK1
  • NK28

Background

CD160, also known as BY55 and NK1, belongs to a class of natural killer (NK) receptors known as the major histocompatibility complex (MCH) class I-dependent NK cell activating receptor (1). CD160 exists as either a glycosylphosphatidylinositol (GPI)-anchored isoform or a transmembrane protein and is expressed on NK cells and cytotoxic T lymphocytes, as well as endothelial cells (1-3). CD160 has both stimulatory and inhibitory receptor functions and regulates cell differentiation and activation (2). The human CD160 protein is 181 amino acids (aa) in length with a theoretical molecular weight (MW) of 19.8 kDa (2,3). However, given that the CD160 protein is subject to glycosylation, addition of disulfide bonds, lipidation, and propitiation, the observed MW is often much higher (2). The human CD160 protein consists of a single immunoglobulin (Ig)-like domain (25-133 aa) and does not contain any immunoreceptor tyrosine-based activation motifs (ITSMs) (2). Thus, CD160 requires the recruitment of adaptor proteins such as phosphoinositide-3 kinase (PI3K) to promote cytotoxic functions including cytokine secretion (1,3).

Identified ligands for CD160 include MHC class I proteins and herpes virus entry mediators (HVEM), each of which has a different effect on NK or T cells (1,3-5). CD160 binds to MHC class I proteins with weaker affinity, but the interaction causes NK cell cytotoxic function and cytokine production (1,3). CD160 engagement of MHC class I proteins and/or HVEM within NK cells promotes ERK1/2 and AKT activation and production of interferon gamma (IFNgamma) (5). Conversely, CD160 binding of HVEM in CD4+ T cells induces inhibitory signaling, signifying both a stimulatory and inhibitory role for CD160 as well as cell-specific context (4,5). Additionally, CD160 plays a role in diseases including certain types of cancer, such as thyroid cancer and colon cancer, viral infections, and autoimmune diseases (3,5). CD160 expression levels on CD8+ T cells have been shown to be elevated in chronic viral infections such as human immunodeficiency virus (HIV) and Epstein Barr virus (EBV) (3). In addition, when CD160 is co-expressed with the programmed cell death protein 1 (PD-1) receptor, T cell exhaustion occurs due to persistent stimulation, leading to inhibited immune response and ability to combat infection (3). CD160 may be a promising therapeutic target in cancer as murine studies have demonstrated that blocking the CD160-HVEM pathway causes a regression of neoplastic tumors in a thyroid cancer model (3-5).

References

1. Le Bouteiller P, Tabiasco J, Polgar B, et al. CD160: a unique activating NK cell receptor. Immunol Lett. 2011;138(2):93-96. https://doi.org/10.1016/j.imlet.2011.02.003

2. Uniprotkb (O95971)

3. Piotrowska M, Spodzieja M, Kuncewicz K, Rodziewicz-Motowidlo S, Orlikowska M. CD160 protein as a new therapeutic target in a battle against autoimmune, infectious and lifestyle diseases. Analysis of the structure, interactions and functions. Eur J Med Chem. 2021;224:113694. https://doi.org/10.1016/j.ejmech.2021.113694

4. Cai G, Freeman GJ. The CD160, BTLA, LIGHT/HVEM pathway: a bidirectional switch regulating T-cell activation. Immunol Rev. 2009;229(1):244-258. https://doi.org/10.1111/j.1600-065X.2009.00783.x

5. Sedy JR, Ramezani-Rad P. HVEM network signaling in cancer. Adv Cancer Res. 2019;142:145-186. https://doi.org/10.1016/bs.acr.2019.01.004

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
485-MI
Species: Mu
Applications: BA
202-IL
Species: Hu
Applications: BA
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
294-HG
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD

Publications for CD160 Antibody (H00011126-B01P) (0)

There are no publications for CD160 Antibody (H00011126-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD160 Antibody (H00011126-B01P) (0)

There are no reviews for CD160 Antibody (H00011126-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD160 Antibody (H00011126-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD160 Products

Research Areas for CD160 Antibody (H00011126-B01P)

Find related products by research area.

Blogs on CD160

There are no specific blogs for CD160, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD160 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD160
Entrez
Uniprot