CCT6B Antibody - BSA Free

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 0.2-1 ug/ml

Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCT6B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CCT6B(chaperonin containing TCP1, subunit 6B (zeta 2)) The peptide sequence was selected from the N terminal of CCT6B. Peptide sequence VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: zeta-2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCT6B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCT6B Antibody - BSA Free

• Cctz2
• CCTZ-2
• CCT-zeta-2
• CCT-zeta-like
• chaperonin containing TCP1, subunit 6B (zeta 2)
• T-complex protein 1 subunit zeta-2
• T-complex protein 1, zeta-2 subunit
• TCP-1-zeta-2
• TCP-1-zeta-like
• Testis-specific protein TSA303
• Testis-specific Tcp20
• TSA303

Background

CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCT6B