Recombinant Human CCNB1IP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CCNB1IP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-277 of Human CCNB1IP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI

Protein/Peptide Type
Recombinant Protein
Gene
CCNB1IP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
No additives

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CCNB1IP1 Protein

  • chromosome 14 open reading frame 18
  • cyclin B1 interacting protein 1
  • cyclin B1 interacting protein 1, E3 ubiquitin protein ligase
  • E3 ubiquitin-protein ligase CCNB1IP1
  • EC 6.3.2.-
  • enhancer of invasion 10
  • HEI10C14orf18Cyclin-B1-interacting protein 1
  • Human enhancer of invasion 10

Background

HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP

Publications for CCNB1IP1 Recombinant Protein (H00057820-P01) (0)

There are no publications for CCNB1IP1 Recombinant Protein (H00057820-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCNB1IP1 Recombinant Protein (H00057820-P01) (0)

There are no reviews for CCNB1IP1 Recombinant Protein (H00057820-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCNB1IP1 Recombinant Protein (H00057820-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCNB1IP1 Products

Bioinformatics Tool for CCNB1IP1 Recombinant Protein (H00057820-P01)

Discover related pathways, diseases and genes to CCNB1IP1 Recombinant Protein (H00057820-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCNB1IP1 Recombinant Protein (H00057820-P01)

Discover more about diseases related to CCNB1IP1 Recombinant Protein (H00057820-P01).
 

Pathways for CCNB1IP1 Recombinant Protein (H00057820-P01)

View related products by pathway.

PTMs for CCNB1IP1 Recombinant Protein (H00057820-P01)

Learn more about PTMs related to CCNB1IP1 Recombinant Protein (H00057820-P01).

Blogs on CCNB1IP1

There are no specific blogs for CCNB1IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CCNB1IP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNB1IP1