CCDC88B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC88B Antibody [NBP1-88350] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.
Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside the reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC88B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC88B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC88B Protein (NBP1-88350PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC88B Antibody

  • 78 kDa glucose-regulated protein GRP78-interacting protein induced by ER stress
  • brain leucine zipper domain-containing protein
  • brain leucine zipper protein
  • CCDC88
  • coiled-coil domain containing 88B
  • coiled-coil domain-containing protein 88B
  • gipie
  • HKRP3
  • hook-related protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5345
Species: Hu
Applications: WB
NBP1-69621
Species: Hu
Applications: WB
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-83092
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5345
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for CCDC88B Antibody (NBP1-88350) (0)

There are no publications for CCDC88B Antibody (NBP1-88350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC88B Antibody (NBP1-88350) (0)

There are no reviews for CCDC88B Antibody (NBP1-88350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC88B Antibody (NBP1-88350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC88B Products

Bioinformatics Tool for CCDC88B Antibody (NBP1-88350)

Discover related pathways, diseases and genes to CCDC88B Antibody (NBP1-88350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC88B Antibody (NBP1-88350)

Discover more about diseases related to CCDC88B Antibody (NBP1-88350).

Blogs on CCDC88B

There are no specific blogs for CCDC88B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC88B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC88B