CCDC88B Antibody - BSA Free

Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside the reaction centra.

Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: CCDC88B Antibody [NBP1-88350] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC88B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLRQEGPEHKPGPSEPSSVQLEEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESLASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCDC88B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCDC88B Protein (NBP1-88350PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCDC88B Antibody - BSA Free

• 78 kDa glucose-regulated protein GRP78-interacting protein induced by ER stress
• brain leucine zipper domain-containing protein
• brain leucine zipper protein
• CCDC88
• coiled-coil domain containing 88B
• coiled-coil domain-containing protein 88B
• gipie
• HKRP3
• hook-related protein 3

Background

CCDC88B, also known as Coiled-coil domain-containing protein 88B, has 6 isoforms, a 1476 amino acid isoform that is 165 kDa, a 1034 amino acid isoform that is 114 kDa, a 621 amino acid isoform that is 67 kDa, a 1358 amino acid isoform that is 151 kDa, 696 amino acid isoform that is 79 kDa, and a 139 amino acid isoform that is 15 kDa; and may be involved in linking organelles to microtubules. This protein has been associated with LPS-induced acute lung injury, cerulein induced chronic pancreatitis, Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema, and Smith-Lemli-Opitz syndrome. CCDC88B interacts with PLEKHA5, PBX2, MAP3K7 and GRP78 in signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCDC88B