CCDC84 Antibody

Images

 
Immunohistochemistry: CCDC84 Antibody [NBP2-14456] - Staining of human uterus, pre-menopause shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC84 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEV VRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC84
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCDC84 Protein (NBP2-14456PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC84 Antibody

  • coiled-coil domain containing 84
  • coiled-coil domain-containing protein 84
  • DLNB14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17046
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P
MAB3167
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81150
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-10820
Species: Hu
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-56628
Species: Hu
Applications: WB
26520002
Species: Hu
Applications: WB, ELISA
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46204
Species: Hu
Applications: WB, Flow, IHC
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15229
Species: Hu
Applications: WB
NBP2-14113
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC

Publications for CCDC84 Antibody (NBP2-14456) (0)

There are no publications for CCDC84 Antibody (NBP2-14456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC84 Antibody (NBP2-14456) (0)

There are no reviews for CCDC84 Antibody (NBP2-14456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCDC84 Antibody (NBP2-14456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC84 Products

Bioinformatics Tool for CCDC84 Antibody (NBP2-14456)

Discover related pathways, diseases and genes to CCDC84 Antibody (NBP2-14456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCDC84

There are no specific blogs for CCDC84, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC84 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC84